GCF_003798325.1_ASM379832v1_genomic - 10 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP033719.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	NRPS	646,159	698,983
Region 2	NRPS,NRPS-like	982,467	1,041,573
Region 3	sactipeptide	1,249,543	1,270,958
Region 4	arylpolyene	1,333,477	1,374,736	natamycin	Polyketide	9%
Region 5	lanthipeptide-class-iii	1,479,984	1,502,716
Region 6	lassopeptide	1,902,425	1,924,949	siamycin	RiPP	33%
Region 7	RiPP-like	1,951,569	1,963,470
Region 8	NRPS	2,071,647	2,124,177	streptobactin	NRP	11%
Region 9	thiopeptide	2,370,578	2,396,770	clifednamide A	NRP + Polyketide	30%
Region 10	T2PKS	2,906,566	2,979,107	resistomycin / resistoflavine	Polyketide:Type II	33%

NZ_CP033719.1 - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 646,159 - 698,983 nt. (total: 52,825 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000389.1	0.24	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0000412.1	0.24	NRP	pyochelin	Pseudomonas aeruginosa PAO1
BGC0000373.1	0.23	NRP	holomycin	Streptomyces clavuligerus ATCC 27064
BGC0000417.1	0.21	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001636.1	0.21	NRP	KK-1	Curvularia clavata
BGC0001699.1	0.21	Polyketide	nidulanin A	Aspergillus nidulans FGSC A4
BGC0001758.1	0.21	NRP	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001131.1	0.21	NRP	ambactin	Xenorhabdus miraniensis
BGC0001641.1	0.20	NRP	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.1	0.20	NRP	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000389.1	0.58	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0000412.1	0.57	NRP	pyochelin	Pseudomonas aeruginosa PAO1
BGC0000373.1	0.56	NRP	holomycin	Streptomyces clavuligerus ATCC 27064
BGC0000417.1	0.53	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001636.1	0.53	NRP	KK-1	Curvularia clavata
BGC0001699.1	0.53	Polyketide	nidulanin A	Aspergillus nidulans FGSC A4
BGC0001758.1	0.53	NRP	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454
BGC0001131.1	0.53	NRP	ambactin	Xenorhabdus miraniensis
BGC0001641.1	0.53	NRP	kolossin	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001135.1	0.53	NRP	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis

Similar known gene clusters

No matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 646158 - 698983:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (Me-cys) + (cys - cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_573

Search NORINE for peptide: strict or relaxed

AMP-binding (582..976): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSmIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (1992..2395): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

ctg1_574

Search NORINE for peptide: strict or relaxed

AMP-binding (33..444): X

NRPSPredictor2: dhb, sal

SVM prediction details:

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: dhb, sal
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: PLPAlGgttK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 60% (weak)

ctg1_576

Search NORINE for peptide: strict or relaxed

AMP-binding (536..928): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLYNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

NZ_CP033719.1 - Region 2 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 982,467 - 1,041,573 nt. (total: 59,107 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000373.1	0.52	NRP	holomycin	Streptomyces clavuligerus ATCC 27064
BGC0000412.1	0.48	NRP	pyochelin	Pseudomonas aeruginosa PAO1
BGC0000389.1	0.48	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0001343.1	0.46	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0001538.1	0.43	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0001185.1	0.43	NRP	bacillibactin	Bacillus velezensis FZB42
BGC0001636.1	0.43	NRP	KK-1	Curvularia clavata
BGC0000352.1	0.42	NRP	fimsbactin A	Acinetobacter sp. ADP1
BGC0001699.1	0.41	Polyketide	nidulanin A	Aspergillus nidulans FGSC A4
BGC0001844.1	0.41	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000373.1	0.61	NRP	holomycin	Streptomyces clavuligerus ATCC 27064
BGC0001343.1	0.59	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000412.1	0.58	NRP	pyochelin	Pseudomonas aeruginosa PAO1
BGC0000389.1	0.57	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0001538.1	0.57	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0001591.1	0.55	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.55	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0000352.1	0.55	NRP	fimsbactin A	Acinetobacter sp. ADP1
BGC0000249.1	0.55	Polyketide	nogalamycin	Streptomyces nogalater
BGC0001444.1	0.54	Other	caboxamycin	Streptomyces sp. NTK 937

Similar known gene clusters

No matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 982466 - 1041573:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 3, location 982466 - 1033985:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 4, location 1000855 - 1041573:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - cys) + (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_860

Search NORINE for peptide: strict or relaxed

AMP-binding (575..954): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

AMP-binding (1601..1985): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

ctg1_861

Search NORINE for peptide: strict or relaxed

AMP-binding (521..900): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

ctg1_863

Search NORINE for peptide: strict or relaxed

AMP-binding (12..407): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: egaFVAvmLK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 50% (weak)

ctg1_867

Search NORINE for peptide: strict or relaxed

AMP-binding (34..447): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: AMPplGVVaK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 70% (weak)

ctg1_868

Search NORINE for peptide: strict or relaxed

AMP-binding (152..556): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: AnPAQGVVcK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 80% (moderate)

NZ_CP033719.1 - Region 3 - sactipeptide

Download region GenBank file

Download region SVG

Location: 1,249,543 - 1,270,958 nt. (total: 21,416 nt) Show pHMM detection rules used

sactipeptide: (subtilosin or thuricin or TIGR04404 or Subtilosin_A or skfc)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Sactipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.1	0.17	RiPP	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000783.1	0.17	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000780.1	0.16	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0001929.1	0.16	RiPP	WGK	Streptococcus ferus
BGC0000601.1	0.15	RiPP	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000736.1	0.13	Saccharide	capsular polysaccharide	Mannheimia haemolytica
BGC0000643.1	0.13	Terpene	carotenoid	Brevundimonas vesicularis
BGC0000523.1	0.12	RiPP	lactocin S	Lactobacillus sakei
BGC0000568.1	0.12	RiPP	microcin B17	Escherichia coli
BGC0000497.1	0.11	RiPP	BHT-Aα, BHT-Aβ	Streptococcus ratti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000602.1	0.49	RiPP	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0000783.1	0.48	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000780.1	0.46	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0001929.1	0.46	RiPP	WGK	Streptococcus ferus
BGC0000601.1	0.45	RiPP	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000736.1	0.41	Saccharide	capsular polysaccharide	Mannheimia haemolytica
BGC0000643.1	0.41	Terpene	carotenoid	Brevundimonas vesicularis
BGC0000523.1	0.41	RiPP	lactocin S	Lactobacillus sakei
BGC0000568.1	0.40	RiPP	microcin B17	Escherichia coli
BGC0000497.1	0.37	RiPP	BHT-Aα, BHT-Aβ	Streptococcus ratti

Similar known gene clusters

No matches found.

Sactipeptide predictions

Sactipeptides - No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Sactipeptides

Core peptide predictions

No core peptides found.

NZ_CP033719.1 - Region 4 - arylpolyene

Download region GenBank file

Download region SVG

Location: 1,333,477 - 1,374,736 nt. (total: 41,260 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.1	0.28	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.27	Other	bacilysin	Bacillus sp. CS93
BGC0001526.1	0.22	Other	bartolosides E, bartolosides F, bartolosides G, bartolosides H, bartolosides I, bartolosides J, bartolosides K	Synechocystis salina LEGE 06099
BGC0001510.1	0.21	Other	anisomycin	Streptomyces hygrospinosus
BGC0001525.1	0.20	Other	bartoloside 2, bartoloside 3, bartoloside 4	Synechocystis salina LEGE 06155
BGC0000714.1	0.20	Saccharide	sisomicin	Micromonospora inyonensis
BGC0000204.1	0.20	Polyketide	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000679.1	0.20	Terpene	diazepinomicin	Micromonospora sp. M42
BGC0001177.1	0.19	Polyketide	mensacaricin	Streptomyces bottropensis
BGC0002008.1	0.19	Other	aryl polyenes	Xenorhabdus doucetiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.1	0.61	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.61	Other	bacilysin	Bacillus sp. CS93
BGC0001526.1	0.54	Other	bartolosides E, bartolosides F, bartolosides G, bartolosides H, bartolosides I, bartolosides J, bartolosides K	Synechocystis salina LEGE 06099
BGC0001510.1	0.54	Other	anisomycin	Streptomyces hygrospinosus
BGC0001525.1	0.53	Other	bartoloside 2, bartoloside 3, bartoloside 4	Synechocystis salina LEGE 06155
BGC0000714.1	0.53	Saccharide	sisomicin	Micromonospora inyonensis
BGC0000204.1	0.52	Polyketide	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0000679.1	0.52	Terpene	diazepinomicin	Micromonospora sp. M42
BGC0001177.1	0.51	Polyketide	mensacaricin	Streptomyces bottropensis
BGC0002008.1	0.51	Other	aryl polyenes	Xenorhabdus doucetiae

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

NZ_CP033719.1 - Region 5 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 1,479,984 - 1,502,716 nt. (total: 22,733 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.1	0.35	RiPP	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.1	0.35	RiPP	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.1	0.28	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000501.1	0.28	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.1	0.19	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000546.1	0.18	RiPP	SAL-2242	Streptomyces albidoflavus
BGC0000519.1	0.17	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000527.1	0.17	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001210.1	0.17	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001787.1	0.17	RiPP	suicin 3908	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000513.1	0.68	RiPP	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0000553.1	0.68	RiPP	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000551.1	0.62	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000501.1	0.61	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000496.1	0.51	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000546.1	0.49	RiPP	SAL-2242	Streptomyces albidoflavus
BGC0000519.1	0.49	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000527.1	0.48	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001210.1	0.48	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001787.1	0.47	RiPP	suicin 3908	Streptococcus suis

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_1247 - Putative Class III

ctg1_1248 leader / core peptide: MHGILVLQSLDTHSEPTRSPSN - WDhaNWDhbCYDhaDhbRDhaIWFC
ctg1_1251 leader / core peptide: MQYILDLQRTETEPTGGMR - DhbCNPVDhaFADhaCDhaLCDhaVDhaFADhaVAVCLDhbV

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_1248 - Class III

Cleavage pHMM score: 3.80

RODEO score: 0

Monoisotopic mass: 1848.8 Da

Molecular weight: 1850.1 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1868.1 Da N = 1; 1886.1 Da N = 2; 1904.1 Da N = 3

ctg1_1251 - Class III

Cleavage pHMM score: 7.50

RODEO score: 0

Monoisotopic mass: 2450.2 Da

Molecular weight: 2451.9 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 2469.9 Da N = 1; 2487.9 Da N = 2; 2505.9 Da N = 3; 2523.9 Da N = 4

NZ_CP033719.1 - Region 6 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1,902,425 - 1,924,949 nt. (total: 22,525 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lasso peptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.1	0.34	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.1	0.34	RiPP	lariatin	Rhodococcus jostii
BGC0001548.1	0.32	RiPP	citrulassin A	Streptomyces albulus
BGC0001539.1	0.32	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001356.1	0.32	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001307.1	0.31	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001889.1	0.31	RiPP	fusilassin	Thermobifida fusca YX
BGC0001645.1	0.30	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.1	0.30	RiPP	citrulassin E	Streptomyces glaucescens
BGC0001673.1	0.28	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.1	0.67	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.1	0.67	RiPP	lariatin	Rhodococcus jostii
BGC0001548.1	0.65	RiPP	citrulassin A	Streptomyces albulus
BGC0001539.1	0.65	RiPP	cattlecin	Streptomyces cattleya NRRL 8057 = DSM 46488
BGC0001356.1	0.65	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001307.1	0.65	RiPP	chaxapeptin	Streptomyces leeuwenhoekii
BGC0001889.1	0.64	RiPP	fusilassin	Thermobifida fusca YX
BGC0001645.1	0.64	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001551.1	0.63	RiPP	citrulassin E	Streptomyces glaucescens
BGC0001673.1	0.62	RiPP	moomysin	Streptomyces cattleya NRRL 8057 = DSM 46488

Similar known gene clusters

Lasso peptide predictions

Lassopeptide(s) for allorf_1912032_1912307 - Putative Class II

allorf_1912032_1912307 leader / core peptide / cleaved tail: LVGRPDIIRCQSCVQMLTELKTELKEVRELCYAQLNRAVEAARQEGGSDMYETPVLTRIADFADATN - GAGHAPLKDVWGFRALAVVYWPWS

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

Core peptide predictions

allorf_1912032_1912307 - Class II: Cleavage pHMM score: 1.40; RODEO score: 19; Monoisotopic mass: 2664.4 Da; Molecular weight: 2666.0 Da; Number of bridges: 0

NZ_CP033719.1 - Region 7 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,951,569 - 1,963,470 nt. (total: 11,902 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.1	0.17	Other	3-demethylchuangxinmycin	Actinoplanes tsinanensis
BGC0001546.1	0.17	Alkaloid	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.1	0.07	RiPP	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.1	0.07	RiPP	bottromycin A2	Streptomyces bottropensis
BGC0000470.1	0.07	RiPP	bottromycin D	Streptomyces sp. WMMB 272
BGC0000469.1	0.05	RiPP	bottromycin A2	Streptomyces sp. BC16019
BGC0000604.1	0.05	RiPP	GE2270A	Nonomuraea sp. WU8817
BGC0001155.1	0.05	RiPP	GE2270	Planobispora rosea

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001485.1	0.48	Other	3-demethylchuangxinmycin	Actinoplanes tsinanensis
BGC0001546.1	0.48	Alkaloid	chuangxinmycin	Actinoplanes tsinanensis
BGC0001157.1	0.28	RiPP	bottromycin A2	Streptomyces scabiei 87.22
BGC0000468.1	0.28	RiPP	bottromycin A2	Streptomyces bottropensis
BGC0000470.1	0.27	RiPP	bottromycin D	Streptomyces sp. WMMB 272
BGC0000469.1	0.23	RiPP	bottromycin A2	Streptomyces sp. BC16019
BGC0000604.1	0.22	RiPP	GE2270A	Nonomuraea sp. WU8817
BGC0001155.1	0.21	RiPP	GE2270	Planobispora rosea

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP033719.1 - Region 8 - NRPS

Download region GenBank file

Download region SVG

Location: 2,071,647 - 2,124,177 nt. (total: 52,531 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001985.1	0.21	Other	pyrazomycin	Streptomyces candidus
BGC0001636.1	0.21	NRP	KK-1	Curvularia clavata
BGC0001591.1	0.21	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.21	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001343.1	0.21	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0001699.1	0.21	Polyketide	nidulanin A	Aspergillus nidulans FGSC A4
BGC0001863.1	0.20	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0000484.1	0.20	RiPP	glycocin F	Lactobacillus plantarum
BGC0000347.1	0.20	NRP	equibactin	Streptococcus equi subsp. equi
BGC0001862.1	0.20	RiPP	geocillicin	Aeribacillus pallidus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001985.1	0.54	Other	pyrazomycin	Streptomyces candidus
BGC0001636.1	0.54	NRP	KK-1	Curvularia clavata
BGC0001591.1	0.54	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.54	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001343.1	0.53	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0001699.1	0.53	Polyketide	nidulanin A	Aspergillus nidulans FGSC A4
BGC0001863.1	0.52	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0000484.1	0.52	RiPP	glycocin F	Lactobacillus plantarum
BGC0000347.1	0.52	NRP	equibactin	Streptococcus equi subsp. equi
BGC0001862.1	0.52	RiPP	geocillicin	Aeribacillus pallidus

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 10, location 2071646 - 2124177:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys - Me-cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1744

Search NORINE for peptide: strict or relaxed

AMP-binding (469..856): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSmIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 90% (moderate)

AMP-binding (2832..3218): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNLSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

NZ_CP033719.1 - Region 9 - thiopeptide

Download region GenBank file

Download region SVG

Location: 2,370,578 - 2,396,770 nt. (total: 26,193 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Thiopeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000542.1	0.22	RiPP	paenicidin B	Paenibacillus terrae
BGC0000541.1	0.22	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000568.1	0.21	RiPP	microcin B17	Escherichia coli
BGC0000605.1	0.19	RiPP	GE37468	Streptomyces sp. ATCC 55365
BGC0001171.1	0.18	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000556.1	0.17	RiPP	streptin	Streptococcus pyogenes
BGC0000560.1	0.17	RiPP	subtilomycin	Bacillus subtilis
BGC0001727.1	0.17	RiPP	paenilan	Paenibacillus polymyxa E681
BGC0001655.1	0.17	RiPP	LP2006	Nocardiopsis alba DSM 43377
BGC0000554.1	0.17	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000542.1	0.55	RiPP	paenicidin B	Paenibacillus terrae
BGC0000541.1	0.55	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000568.1	0.53	RiPP	microcin B17	Escherichia coli
BGC0000605.1	0.51	RiPP	GE37468	Streptomyces sp. ATCC 55365
BGC0001171.1	0.50	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000556.1	0.49	RiPP	streptin	Streptococcus pyogenes
BGC0000560.1	0.48	RiPP	subtilomycin	Bacillus subtilis
BGC0001727.1	0.48	RiPP	paenilan	Paenibacillus polymyxa E681
BGC0001655.1	0.48	RiPP	LP2006	Nocardiopsis alba DSM 43377
BGC0000554.1	0.48	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Similar known gene clusters

Thiopeptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Thiopeptides

Core peptide predictions

No core peptides found.

NZ_CP033719.1 - Region 10 - T2PKS

Download region GenBank file

Download region SVG

Location: 2,906,566 - 2,979,107 nt. (total: 72,542 nt) Show pHMM detection rules used

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000248.1	0.29	Polyketide	naphtocyclinone	Streptomyces arenae
BGC0000272.1	0.29	Polyketide	spore pigment	Streptomyces collinus
BGC0001723.1	0.26	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000271.1	0.26	Polyketide	spore pigment	Streptomyces avermitilis
BGC0000231.1	0.25	Polyketide	griseusin	Streptomyces griseus
BGC0001513.1	0.25	Polyketide	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.1	0.24	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.1	0.24	Polyketide	tetracenomycin C	Streptomyces glaucescens
BGC0001366.1	0.24	Polyketide	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000228.1	0.23	Polyketide	granaticin	Streptomyces violaceoruber

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000248.1	0.62	Polyketide	naphtocyclinone	Streptomyces arenae
BGC0000272.1	0.62	Polyketide	spore pigment	Streptomyces collinus
BGC0001723.1	0.59	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000271.1	0.59	Polyketide	spore pigment	Streptomyces avermitilis
BGC0000231.1	0.59	Polyketide	griseusin	Streptomyces griseus
BGC0001513.1	0.59	Polyketide	anthrabenzoxocinone	Actinobacteria bacterium
BGC0000234.1	0.57	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000275.1	0.57	Polyketide	tetracenomycin C	Streptomyces glaucescens
BGC0001366.1	0.57	Polyketide	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2
BGC0000228.1	0.57	Polyketide	granaticin	Streptomyces violaceoruber

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Type II PKS

Type II PKS gene cluster prediction details

Cluster section:: 2906565 to 2979107
Starter unit(s):: acetyl-CoA (Score: 0.0; E-value: 0)

ctg1_2479: MET (Score: 144.0; E-value: 1.4e-44)
ctg1_2481: KS (Score: 476.2; E-value: 1.9e-145)
ctg1_2482: CLF (Score: 362.3; E-value: 6.8e-111)
ctg1_2483: CYC C9-C14 (Score: 123.2; E-value: 1.7e-38)
ctg1_2484: CYC C5-C14/C3-C16 (Score: 256.9; E-value: 4.7e-79)