GCF_905331265.2_AI2999v1_cpp_genomic - 6 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_OW968328.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	T1PKS,NRPS	444,508	492,247	saquayamycin A	Polyketide	5%
Region 1.2	NRPS	1,201,053	1,244,910	colicin V	RiPP	3%
Region 1.3	thiopeptide	1,603,900	1,630,197	O-antigen	Saccharide	14%
Region 1.4	siderophore	3,110,619	3,125,047	aerobactin	Other	66%
Region 1.5	arylpolyene	4,535,580	4,579,173	aryl polyenes	Other	88%

NZ_OW968329.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	lassopeptide	1	19,176	microcin J25	RiPP:Linaridin	100%

No secondary metabolite regions were found in these records:: NZ_OW968330.1

Compact view

NZ_OW968328.1 - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 444,508 - 492,247 nt. (total: 47,740 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.1	0.63	Polyketide	strobilurin	Strobilurus tenacellus
BGC0001281.1	0.49	Polyketide	ustilagic acid	Ustilago maydis 521
BGC0001264.1	0.44	Polyketide	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001280.1	0.44	Polyketide	betaenone C, betaenone A	Phoma betae
BGC0001265.1	0.42	Polyketide	melanin	Bipolaris oryzae
BGC0000107.1	0.41	Polyketide	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.1	0.41	Polyketide	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001906.1	0.41	Polyketide	naphthalene	Daldinia eschscholzii IFB-TL01
BGC0000030.1	0.41	Polyketide	bikaverin	Fusarium fujikuroi IMI 58289
BGC0000057.1	0.41	Polyketide	F9775A, F9775B, orsellinic acid	Aspergillus nidulans FGSC A4

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.1	0.65	Polyketide	strobilurin	Strobilurus tenacellus
BGC0001281.1	0.58	Polyketide	ustilagic acid	Ustilago maydis 521
BGC0001264.1	0.55	Polyketide	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001280.1	0.55	Polyketide	betaenone C, betaenone A	Phoma betae
BGC0001265.1	0.54	Polyketide	melanin	Bipolaris oryzae
BGC0000107.1	0.53	Polyketide	naphthopyrone	Aspergillus nidulans FGSC A4
BGC0001257.1	0.53	Polyketide	1,3,6,8-tetrahydroxynaphthalene	Nodulisporium sp. ATCC74245
BGC0001906.1	0.53	Polyketide	naphthalene	Daldinia eschscholzii IFB-TL01
BGC0000030.1	0.53	Polyketide	bikaverin	Fusarium fujikuroi IMI 58289
BGC0000057.1	0.53	Polyketide	F9775A, F9775B, orsellinic acid	Aspergillus nidulans FGSC A4

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 444507 - 492247:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_432

CAL_domain (180..470): pk

minowa: NH2

Prediction, score:

NH2: 109.7
Acetyl-CoA: 54.3
AHBA: 24.0
shikimic_acid: 16.5
fatty_acid: 14.1

PKS_AT (1171..1451): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 71.1
Methylmalonyl-CoA: 48.4
Methoxymalonyl-CoA: 47.3
inactive: 37.8
2-Methylbutyryl-CoA: 29.5
Ethylmalonyl-CoA: 23.2
Isobutyryl-CoA: 14.8
fatty_acid: 14.6
trans-1,2-CPDA: 11.2
Propionyl-CoA: 1.8
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

NZ_OW968328.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 1,201,053 - 1,244,910 nt. (total: 43,858 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.1	0.36	NRP	bacillibactin	Bacillus velezensis FZB42
BGC0001615.1	0.33	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000401.1	0.30	NRP	paenibactin	Paenibacillus elgii B69
BGC0001184.1	0.27	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.27	Other	bacilysin	Bacillus sp. CS93
BGC0001833.1	0.24	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001197.1	0.24	Polyketide	frankiamicin	Frankia sp. EAN1pec
BGC0001844.1	0.23	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001132.1	0.23	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.1	0.23	NRP	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.1	0.69	NRP	bacillibactin	Bacillus velezensis FZB42
BGC0001615.1	0.66	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000401.1	0.64	NRP	paenibactin	Paenibacillus elgii B69
BGC0001184.1	0.60	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.60	Other	bacilysin	Bacillus sp. CS93
BGC0001833.1	0.58	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001197.1	0.57	Polyketide	frankiamicin	Frankia sp. EAN1pec
BGC0001844.1	0.57	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001132.1	0.56	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001758.1	0.56	NRP	rhizomide A, rhizomide B, rhizomide C	Paraburkholderia rhizoxinica HKI 454

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 1201052 - 1244910:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1125

Search NORINE for peptide: strict or relaxed

AMP-binding (456..856): ser

NRPSPredictor2: ser

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg1_1132

Search NORINE for peptide: strict or relaxed

AMP-binding (35..437): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: aMPSQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)

NZ_OW968328.1 - Region 3 - thiopeptide

Download region GenBank file

Download region SVG

Location: 1,603,900 - 1,630,197 nt. (total: 26,298 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Thiopeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000784.1	0.24	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000781.1	0.16	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001285.1	0.09	Other (Fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001441.1	0.07	Other	belactosin A, belactosin C	Streptomyces sp.
BGC0000981.1	0.07	NRP, Polyketide	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0001302.1	0.06	Other	lomofungin	Streptomyces lomondensis
BGC0002012.1	0.05	Polyketide	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001283.1	0.05	Polyketide	arsono-polyketide	Streptomyces lividans 1326
BGC0000957.1	0.04	NRP, Polyketide	mycotrienin I	Streptomyces sp. XZQH13
BGC0000123.1	0.03	Polyketide	phoslactomycin B	Streptomyces sp. HK803

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000784.1	0.58	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000781.1	0.47	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0001285.1	0.34	Other (Fatty acid)	pseudopyronine A, pseudopyronine B	Pseudomonas putida
BGC0001441.1	0.29	Other	belactosin A, belactosin C	Streptomyces sp.
BGC0000981.1	0.28	NRP, Polyketide	cylindrospermopsin	Aphanizomenon sp. 10E6
BGC0001302.1	0.24	Other	lomofungin	Streptomyces lomondensis
BGC0002012.1	0.23	Polyketide	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001283.1	0.22	Polyketide	arsono-polyketide	Streptomyces lividans 1326
BGC0000957.1	0.19	NRP, Polyketide	mycotrienin I	Streptomyces sp. XZQH13
BGC0000123.1	0.15	Polyketide	phoslactomycin B	Streptomyces sp. HK803

Similar known gene clusters

Thiopeptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Thiopeptides

Core peptide predictions

No core peptides found.

NZ_OW968328.1 - Region 4 - siderophore

Download region GenBank file

Download region SVG

Location: 3,110,619 - 3,125,047 nt. (total: 14,429 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.1	0.56	Other	aerobactin	Pantoea ananatis
BGC0001498.1	0.37	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0001572.1	0.29	Other	desferrioxamine E	Pantoea agglomerans
BGC0001713.1	0.28	Other	ochrobactin	Ochrobactrum anthropi
BGC0000939.1	0.26	Other	aerobactin	Grimontia hollisae
BGC0001870.1	0.24	Other	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001555.1	0.24	RiPP	colicin V	Escherichia coli chi7122
BGC0001478.1	0.22	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.21	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.1	0.21	Other	desferrioxamine	Streptomyces argillaceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001499.1	0.82	Other	aerobactin	Pantoea ananatis
BGC0001498.1	0.69	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0001572.1	0.63	Other	desferrioxamine E	Pantoea agglomerans
BGC0001713.1	0.62	Other	ochrobactin	Ochrobactrum anthropi
BGC0000939.1	0.59	Other	aerobactin	Grimontia hollisae
BGC0001870.1	0.58	Other	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0001555.1	0.57	RiPP	colicin V	Escherichia coli chi7122
BGC0001478.1	0.55	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.54	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.1	0.54	Other	desferrioxamine	Streptomyces argillaceus

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_OW968328.1 - Region 5 - arylpolyene

Download region GenBank file

Download region SVG

Location: 4,535,580 - 4,579,173 nt. (total: 43,594 nt) Show pHMM detection rules used

arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002008.1	0.50	Other	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.1	0.49	Other	APE Ec	Escherichia coli CFT073
BGC0000837.1	0.34	Other	APE Vf	Aliivibrio fischeri ES114
BGC0000228.1	0.25	Polyketide	granaticin	Streptomyces violaceoruber
BGC0001723.1	0.25	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0001895.1	0.22	Polyketide	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000194.1	0.22	Polyketide	actinorhodin	Streptomyces coelicolor A3(2)
BGC0000219.1	0.21	Polyketide, Saccharide	elloramycin	Streptomyces olivaceus
BGC0001897.1	0.21	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0000719.1	0.21	Saccharide	tobramycin	Streptoalloteichus hindustanus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002008.1	0.79	Other	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.1	0.78	Other	APE Ec	Escherichia coli CFT073
BGC0000837.1	0.67	Other	APE Vf	Aliivibrio fischeri ES114
BGC0000228.1	0.59	Polyketide	granaticin	Streptomyces violaceoruber
BGC0001723.1	0.58	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0001895.1	0.55	Polyketide	huanglongmycin A, huanglongmycin B, huanglongmycin C	Streptomyces sp. CB09001
BGC0000194.1	0.55	Polyketide	actinorhodin	Streptomyces coelicolor A3(2)
BGC0000219.1	0.54	Polyketide, Saccharide	elloramycin	Streptomyces olivaceus
BGC0001897.1	0.54	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0000719.1	0.54	Saccharide	tobramycin	Streptoalloteichus hindustanus

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_OW968329.1 - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 1 - 19,176 nt. (total: 19,176 nt) Show pHMM detection rules used

Region on contig edge.

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lasso peptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000581.1	1.00	RiPP	microcin J25	Escherichia coli
BGC0001889.1	0.25	RiPP	fusilassin	Thermobifida fusca YX
BGC0001639.1	0.23	RiPP	klebsidin	Klebsiella pneumoniae
BGC0001549.1	0.23	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.1	0.23	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001550.1	0.23	RiPP	citrulassin D	Streptomyces katrae
BGC0001552.1	0.23	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001356.1	0.22	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001655.1	0.20	RiPP	LP2006	Nocardiopsis alba DSM 43377
BGC0001551.1	0.18	RiPP	citrulassin E	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000581.1	1.00	RiPP	microcin J25	Escherichia coli
BGC0001889.1	0.59	RiPP	fusilassin	Thermobifida fusca YX
BGC0001639.1	0.57	RiPP	klebsidin	Klebsiella pneumoniae
BGC0001549.1	0.56	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001634.1	0.56	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001550.1	0.56	RiPP	citrulassin D	Streptomyces katrae
BGC0001552.1	0.56	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001356.1	0.55	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001655.1	0.52	RiPP	LP2006	Nocardiopsis alba DSM 43377
BGC0001551.1	0.49	RiPP	citrulassin E	Streptomyces glaucescens

Similar known gene clusters

Lasso peptide predictions

Lassopeptide(s) for ctg2_11 - Putative Class II

ctg2_11 leader / core peptide / cleaved tail: MIKHFHFNKLSSGKKNNVPSPAKGVIQIKKSASQLTK - GGAGHVPEYFVGIGTPISFYG

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

Core peptide predictions

ctg2_11 - Class II: Cleavage pHMM score: 5.40; RODEO score: 23; Monoisotopic mass: 2106.0 Da; Molecular weight: 2107.3 Da; Number of bridges: 0