GCF_000175375.1_ASM17537v1_genomic - 5 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_ACSH02000004 (original name was: NZ_ACSH02000004.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	T1PKS	112,205	157,112
Region 5.2	lanthipeptide-class-ii	232,872	255,472

NZ_ACSH02000002 (original name was: NZ_ACSH02000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	siderophore	65,566	78,211
Region 7.2	NRPS	309,082	352,942	amonabactin P 750	NRP	42%
Region 7.3	terpene	536,200	557,126	carotenoid	Terpene	25%

Region	Type	From	To	Most similar known cluster	Similarity
Region 5.1	T1PKS	112,205	157,112
Region 5.2	lanthipeptide-class-ii	232,872	255,472
Region 7.1	siderophore	65,566	78,211
Region 7.2	NRPS	309,082	352,942	amonabactin P 750	NRP	42%
Region 7.3	terpene	536,200	557,126	carotenoid	Terpene	25%

No secondary metabolite regions were found in these records:: NZ_ACSH02000008 (original name was: NZ_ACSH02000008.1); NZ_ACSH02000007 (original name was: NZ_ACSH02000007.1); NZ_ACSH02000006 (original name was: NZ_ACSH02000006.1); NZ_ACSH02000005 (original name was: NZ_ACSH02000005.1); NZ_ACSH02000003 (original name was: NZ_ACSH02000003.1)

Compact view

c00005_NZ_ACSH.. - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 112,205 - 157,112 nt. (total: 44,908 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.1	0.32	Polyketide	strobilurin	Strobilurus tenacellus
BGC0001831.1	0.24	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001897.1	0.21	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001343.1	0.21	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000044.1	0.21	Polyketide	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0001591.1	0.19	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.19	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001264.1	0.19	Polyketide	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001280.1	0.19	Polyketide	betaenone C, betaenone A	Phoma betae
BGC0001273.1	0.19	Polyketide	asperlactone	Aspergillus ochraceus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001909.1	0.65	Polyketide	strobilurin	Strobilurus tenacellus
BGC0001831.1	0.58	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001897.1	0.54	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001343.1	0.53	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000044.1	0.53	Polyketide	dawenol	Stigmatella aurantiaca DW4/3-1
BGC0001591.1	0.52	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.52	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001264.1	0.52	Polyketide	betaenone A, betaenone B, betaenone C	Phoma betae
BGC0001280.1	0.52	Polyketide	betaenone C, betaenone A	Phoma betae
BGC0001273.1	0.51	Polyketide	asperlactone	Aspergillus ochraceus

Similar known gene clusters

No matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 112204 - 157112:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_127

CAL_domain (66..536): pk

minowa: Acetyl-CoA

Prediction, score:

Acetyl-CoA: 17.3
NH2: 16.2
AHBA: 10.6
shikimic_acid: 10.4
fatty_acid: -0.8

ctg5_129

PKS_AT (643..934): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 62.5%

minowa: fatty_acid

Prediction, score:

fatty_acid: 115.4
Methylmalonyl-CoA: 70.4
Methoxymalonyl-CoA: 66.9
Malonyl-CoA: 66.9
Isobutyryl-CoA: 49.2
Ethylmalonyl-CoA: 44.5
Propionyl-CoA: 43.0
2-Methylbutyryl-CoA: 36.0
Acetyl-CoA: 31.8
CHC-CoA: 29.9
trans-1,2-CPDA: 28.6
Benzoyl-CoA: 14.5
3-Methylbutyryl-CoA: 14.2
inactive: 8.9

c00005_NZ_ACSH.. - Region 2 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 232,872 - 255,472 nt. (total: 22,601 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.35	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000626.1	0.28	RiPP	thuricin	Bacillus thuringiensis
BGC0000500.1	0.27	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000521.1	0.26	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000528.1	0.25	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.1	0.25	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000563.1	0.25	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000516.1	0.25	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000503.1	0.24	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0001787.1	0.23	RiPP	suicin 3908	Streptococcus suis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.68	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000626.1	0.62	RiPP	thuricin	Bacillus thuringiensis
BGC0000500.1	0.61	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000521.1	0.60	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000528.1	0.58	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000517.1	0.58	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000563.1	0.58	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000516.1	0.58	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000503.1	0.57	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0001787.1	0.57	RiPP	suicin 3908	Streptococcus suis

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg5_226 - Putative Class II

ctg5_222 leader / core peptide: VVCHLDQLLAEREMTLAA - LADQVGVDhbVANLDhaVLKNNRAKAVRFDhbDhbLVALCDALDCQPGDLFDhbAE
ctg5_223 leader / core peptide: MNASTAVLDSTILDELDKELEAQIIKELEPEMFG - LDhaRLLGNNGRWCDhbIDhbKECMPDhaCN
ctg5_224 leader / core peptide: MNQQPSNHDRVQNYSQDELRAMIENEEAVDGG - DhbHPDhaDhbLIPIDhaIALCPDhbDhbRCDhaRRC
ctg5_225 leader / core peptide: MKKYTKQEWAYTTIGLALGVAVALSLGQGNYMMGA - LDhaAFFGICGYLLARKDhaARKQ
allorf_235152_235298 leader / core peptide: VCVVARAWHAYGGVVAAA - CVAVPVVGVLDhaWDhaDhaGCGADhbPDhaLAPNREDhaIA
allorf_237797_238033 leader / core peptide: MAVAGSRLAMRWGCKFGGLGFAGA - VMPWDhaWFFYKDhaQPDhbKPAADhaLGIRFPELEFRFWAFPVPGPMGAAFLKLQLDhaDhbCEA
allorf_238090_238173 leader / core peptide: VGVCAGSSNFA - CDGGGEGDhbLAAYRIDhbI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg5_222 - Class II

Cleavage pHMM score: -2.00

RODEO score: 0

Monoisotopic mass: 4769.5 Da

Molecular weight: 4772.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 4790.5 Da N = 1; 4808.5 Da N = 2; 4826.5 Da N = 3

ctg5_223 - Class II

Cleavage pHMM score: -4.00

RODEO score: 0

Monoisotopic mass: 2523.2 Da

Molecular weight: 2524.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2543.0 Da N = 1

ctg5_224 - Class II

Cleavage pHMM score: -3.50

RODEO score: 0

Monoisotopic mass: 2399.3 Da

Molecular weight: 2400.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2418.9 Da N = 1; 2436.9 Da N = 2; 2454.9 Da N = 3; 2472.9 Da N = 4

ctg5_225 - Class II

Cleavage pHMM score: -6.30

RODEO score: 0

Monoisotopic mass: 2192.2 Da

Molecular weight: 2193.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2211.6 Da N = 1

allorf_235152_235298 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2818.5 Da

Molecular weight: 2820.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2838.2 Da N = 1; 2856.3 Da N = 2; 2874.3 Da N = 3; 2892.3 Da N = 4

allorf_237797_238033 - Class II

Cleavage pHMM score: -6.80

RODEO score: 0

Monoisotopic mass: 6069.1 Da

Molecular weight: 6073.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6091.1 Da N = 1; 6109.1 Da N = 2; 6127.2 Da N = 3; 6145.2 Da N = 4; 6163.2 Da N = 5

allorf_238090_238173 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 1559.8 Da

Molecular weight: 1560.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1578.7 Da N = 1

c00007_NZ_ACSH.. - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 65,566 - 78,211 nt. (total: 12,646 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001498.1	0.18	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000939.1	0.17	Other	aerobactin	Grimontia hollisae
BGC0001870.1	0.16	Other	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000783.1	0.16	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000772.1	0.16	Saccharide	lipopolysaccharide	Brucella melitensis
BGC0000554.1	0.16	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000774.1	0.16	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0000775.1	0.16	Saccharide	lipopolysaccharide	Legionella pneumophila
BGC0000785.1	0.15	Saccharide	O-antigen	Burkholderia mallei
BGC0000489.1	0.15	RiPP	enterocin AS-48	Enterococcus faecalis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001498.1	0.50	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338
BGC0000939.1	0.48	Other	aerobactin	Grimontia hollisae
BGC0001870.1	0.47	Other	putrebactin, avaroferrin	Xenorhabdus budapestensis
BGC0000783.1	0.47	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000772.1	0.47	Saccharide	lipopolysaccharide	Brucella melitensis
BGC0000554.1	0.47	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000774.1	0.46	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0000775.1	0.46	Saccharide	lipopolysaccharide	Legionella pneumophila
BGC0000785.1	0.46	Saccharide	O-antigen	Burkholderia mallei
BGC0000489.1	0.46	RiPP	enterocin AS-48	Enterococcus faecalis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

c00007_NZ_ACSH.. - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 309,082 - 352,942 nt. (total: 43,861 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001615.1	0.34	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000410.1	0.26	NRP	pseudomonine	Pseudomonas fluorescens
BGC0001128.1	0.24	NRP	luminmide	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.1	0.24	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.1	0.24	NRP	xenematide	Xenorhabdus nematophila AN6/1
BGC0001131.1	0.23	NRP	ambactin	Xenorhabdus miraniensis
BGC0001833.1	0.23	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001343.1	0.23	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000423.1	0.22	NRP	scabichelin	Streptomyces scabiei 87.22
BGC0001844.1	0.22	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001615.1	0.67	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000410.1	0.59	NRP	pseudomonine	Pseudomonas fluorescens
BGC0001128.1	0.57	NRP	luminmide	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001132.1	0.57	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0001825.1	0.57	NRP	xenematide	Xenorhabdus nematophila AN6/1
BGC0001131.1	0.56	NRP	ambactin	Xenorhabdus miraniensis
BGC0001833.1	0.56	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001343.1	0.56	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000423.1	0.56	NRP	scabichelin	Streptomyces scabiei 87.22
BGC0001844.1	0.55	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 309081 - 352942:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg7_306

Search NORINE for peptide: strict or relaxed

AMP-binding (468..849): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHISLIDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg7_309

Search NORINE for peptide: strict or relaxed

AMP-binding (26..432): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: TMPaQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)

c00007_NZ_ACSH.. - Region 3 - terpene

Download region GenBank file

Download region SVG

Location: 536,200 - 557,126 nt. (total: 20,927 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000648.1	0.31	Terpene	carotenoid	Myxococcus xanthus
BGC0000644.1	0.24	Terpene	carotenoid	Dietzia sp. CQ4
BGC0000645.1	0.22	Terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000637.1	0.22	Terpene	carotenoid	Corynebacterium glutamicum
BGC0000650.1	0.22	Terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000664.1	0.20	Terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002009.1	0.19	Polyketide	kanglemycin A, kanglemycin V1, kanglemycin V2	Amycolatopsis vancoresmycina
BGC0000630.1	0.19	Terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001456.1	0.19	Terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.1	0.18	Terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000648.1	0.64	Terpene	carotenoid	Myxococcus xanthus
BGC0000644.1	0.58	Terpene	carotenoid	Dietzia sp. CQ4
BGC0000645.1	0.55	Terpene	carotenoid	Halobacillus halophilus DSM 2266
BGC0000637.1	0.55	Terpene	carotenoid	Corynebacterium glutamicum
BGC0000650.1	0.55	Terpene	carotenoid	Algoriphagus sp. KK10202C
BGC0000664.1	0.53	Terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0002009.1	0.51	Polyketide	kanglemycin A, kanglemycin V1, kanglemycin V2	Amycolatopsis vancoresmycina
BGC0000630.1	0.51	Terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis
BGC0001456.1	0.51	Terpene	isorenieratene	Streptomyces argillaceus
BGC0000649.1	0.50	Terpene	carotenoid	Streptomyces griseus subsp. griseus NBRC 13350

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names