GCF_025148125.1_ASM2514812v1_genomic - 11 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP102267.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	cyclic-lactone-autoinducer	658,396	678,262
Region 2	lanthipeptide-class-ii,ranthipeptide	882,849	919,539	ruminococcin A	RiPP:Lanthipeptide	14%
Region 3	cyclic-lactone-autoinducer	1,137,263	1,161,913
Region 4	cyclic-lactone-autoinducer	1,215,123	1,232,905
Region 5	cyclic-lactone-autoinducer	1,315,798	1,334,601
Region 6	cyclic-lactone-autoinducer	1,465,855	1,484,523
Region 7	NRPS	1,897,541	1,946,525	dipeptide aldehydes	NRP	82%
Region 8	cyclic-lactone-autoinducer	2,164,991	2,185,560
Region 9	lanthipeptide-class-ii	2,189,388	2,211,015	xantholipin	Polyketide	6%
Region 10	ranthipeptide	2,715,265	2,736,853
Region 11	lanthipeptide-class-ii	3,300,589	3,323,282

NZ_CP102267.1 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 658,396 - 678,262 nt. (total: 19,867 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.17	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000616.1	0.16	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.1	0.16	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000783.1	0.16	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000522.1	0.15	RiPP	lacticin Z	Lactococcus lactis
BGC0000928.1	0.15	Other	T3 toxin	Cylindrospermopsis raciborskii T3
BGC0000188.1	0.15	Alkaloid	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000883.1	0.14	Other	arginomycin	Streptomyces arginensis
BGC0000243.1	0.13	Polyketide	macrotetrolide	Streptomyces griseus subsp. griseus
BGC0000550.1	0.13	RiPP	salivaricin G32	Streptococcus salivarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.48	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000616.1	0.46	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000528.1	0.46	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000783.1	0.46	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000522.1	0.46	RiPP	lacticin Z	Lactococcus lactis
BGC0000928.1	0.45	Other	T3 toxin	Cylindrospermopsis raciborskii T3
BGC0000188.1	0.45	Alkaloid	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000883.1	0.43	Other	arginomycin	Streptomyces arginensis
BGC0000243.1	0.42	Polyketide	macrotetrolide	Streptomyces griseus subsp. griseus
BGC0000550.1	0.42	RiPP	salivaricin G32	Streptococcus salivarius

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 2 - lanthipeptide-class-ii,ranthipeptide

Download region GenBank file

Download region SVG

Location: 882,849 - 919,539 nt. (total: 36,691 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.44	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000539.1	0.40	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000626.1	0.38	RiPP	thuricin	Bacillus thuringiensis
BGC0000521.1	0.36	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0001787.1	0.36	RiPP	suicin 3908	Streptococcus suis
BGC0000547.1	0.34	RiPP	salivaricin 9	Streptococcus salivarius
BGC0000561.1	0.34	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000498.1	0.33	RiPP	bovicin HJ50	Streptococcus equinus
BGC0000616.1	0.33	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000486.1	0.32	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.68	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000539.1	0.66	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000516.1	0.66	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000626.1	0.64	RiPP	thuricin	Bacillus thuringiensis
BGC0001787.1	0.64	RiPP	suicin 3908	Streptococcus suis
BGC0000547.1	0.62	RiPP	salivaricin 9	Streptococcus salivarius
BGC0000521.1	0.61	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0001660.1	0.61	RiPP	mathermycin	Marinactinospora thermotolerans
BGC0000599.1	0.61	RiPP	thuricin CD α, thuricin CD β	Bacillus thuringiensis
BGC0001929.1	0.61	RiPP	WGK	Streptococcus ferus

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_785 - Putative Class II

ctg1_784 leader / core peptide: MKKNYRNPMTRPENFMNPAGNVMKEIKEADLNNFSAGAGEPRVSDGS - QFCDhbDhaDhbKECNWGDhbIMFVCC
allorf_0889319_0889417 leader / core peptide: MIRSSIIFFVLNKLQGS - CQVDhaVRFLDhaEKYIIL
allorf_0904958_0905074 leader / core peptide: LKLISHVLPMSKEIKKSAKKTINMVVNAM - DhbWYKECDhbNDhb

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_784 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 2127.9 Da

Molecular weight: 2129.5 Da

Number of bridges: 4

allorf_0889319_0889417 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 1761.0 Da

Molecular weight: 1762.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1780.1 Da N = 1

allorf_0904958_0905074 - Class II

Cleavage pHMM score: -4.50

RODEO score: 0

Monoisotopic mass: 1090.5 Da

Molecular weight: 1091.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1109.2 Da N = 1; 1127.2 Da N = 2

NZ_CP102267.1 - Region 3 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,137,263 - 1,161,913 nt. (total: 24,651 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.1	0.16	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000703.1	0.13	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001311.1	0.11	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0001391.1	0.11	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000541.1	0.10	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000542.1	0.10	RiPP	paenicidin B	Paenibacillus terrae
BGC0000552.1	0.10	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001618.1	0.09	RiPP	hyicin 3682	Staphylococcus hyicus
BGC0001210.1	0.09	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.1	0.09	RiPP	thuricin	Bacillus thuringiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.1	0.46	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000703.1	0.41	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001311.1	0.37	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0001391.1	0.37	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000541.1	0.36	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000542.1	0.36	RiPP	paenicidin B	Paenibacillus terrae
BGC0000552.1	0.36	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001618.1	0.34	RiPP	hyicin 3682	Staphylococcus hyicus
BGC0001210.1	0.34	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000626.1	0.34	RiPP	thuricin	Bacillus thuringiensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 4 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,215,123 - 1,232,905 nt. (total: 17,783 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	cyclic-lactone-autoinducer	Similarity score	Type	Compound(s)	Organism
BGC0000619.1		0.06	RiPP	gassericin T	Lactobacillus gasseri
BGC0001602.1		0.06	RiPP	gassericin-T	Lactobacillus gasseri

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000619.1		0.26	RiPP	gassericin T	Lactobacillus gasseri
BGC0001602.1		0.26	RiPP	gassericin-T	Lactobacillus gasseri

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 5 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,315,798 - 1,334,601 nt. (total: 18,804 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.1	0.16	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0001238.1	0.14	Other	biotin	Aspergillus nidulans
BGC0001239.1	0.14	Other	biotin	Aspergillus nidulans
BGC0001864.1	0.14	RiPP	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0001391.1	0.14	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000243.1	0.14	Polyketide	macrotetrolide	Streptomyces griseus subsp. griseus
BGC0001311.1	0.13	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0000542.1	0.13	RiPP	paenicidin B	Paenibacillus terrae
BGC0000541.1	0.13	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000626.1	0.13	RiPP	thuricin	Bacillus thuringiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000616.1	0.47	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0001238.1	0.44	Other	biotin	Aspergillus nidulans
BGC0001239.1	0.44	Other	biotin	Aspergillus nidulans
BGC0001864.1	0.43	RiPP	listeriocytocin	Listeria monocytogenes SLCC2540
BGC0001391.1	0.43	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000243.1	0.43	Polyketide	macrotetrolide	Streptomyces griseus subsp. griseus
BGC0001311.1	0.42	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0000542.1	0.42	RiPP	paenicidin B	Paenibacillus terrae
BGC0000541.1	0.42	RiPP	paenicidin A	Paenibacillus polymyxa
BGC0000626.1	0.41	RiPP	thuricin	Bacillus thuringiensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 6 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,465,855 - 1,484,523 nt. (total: 18,669 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

No matches found.

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 7 - NRPS

Download region GenBank file

Download region SVG

Location: 1,897,541 - 1,946,525 nt. (total: 48,985 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001575.1	0.61	NRP	dipeptide aldehydes	Ruminococcus sp. 5_1_39BFAA
BGC0000888.1	0.27	Other	bacilysin	Bacillus sp. CS93
BGC0000308.1	0.25	NRP	aureusimine	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0001538.1	0.22	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0002002.1	0.22	NRP	1,6-phenazinedimethanol, fontizine A	Serratia fonticola
BGC0001768.1	0.22	NRP	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0001627.1	0.22	NRP	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001197.1	0.21	Polyketide	frankiamicin	Frankia sp. EAN1pec
BGC0001479.1	0.21	NRP	anabaenopeptin NZ857, nostamide A	Nostoc punctiforme PCC 73102
BGC0000231.1	0.21	Polyketide	griseusin	Streptomyces griseus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001575.1	0.85	NRP	dipeptide aldehydes	Ruminococcus sp. 5_1_39BFAA
BGC0000888.1	0.61	Other	bacilysin	Bacillus sp. CS93
BGC0000308.1	0.59	NRP	aureusimine	Staphylococcus aureus subsp. aureus str. JKD6008
BGC0001538.1	0.55	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0002002.1	0.55	NRP	1,6-phenazinedimethanol, fontizine A	Serratia fonticola
BGC0001768.1	0.55	NRP	sansalvamide	[Nectria] haematococca mpVI 77-13-4
BGC0001627.1	0.54	NRP	isonitrile lipopeptides	Mycobacterium tuberculosis H37Rv
BGC0001197.1	0.54	Polyketide	frankiamicin	Frankia sp. EAN1pec
BGC0001479.1	0.54	NRP	anabaenopeptin NZ857, nostamide A	Nostoc punctiforme PCC 73102
BGC0000231.1	0.53	Polyketide	griseusin	Streptomyces griseus

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 9, location 1897540 - 1946525:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - X - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1713

Search NORINE for peptide: strict or relaxed

AMP-binding (20..419): X

NRPSPredictor2: gly, ala

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: gly, ala
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVLtdgGIsK
Nearest Stachelhaus code:: aeo
Stachelhaus code match:: 60% (weak)

AMP-binding (1033..1421): X

NRPSPredictor2: val, leu, ile, abu, iva

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAmfsGAIfK
Nearest Stachelhaus code:: bht
Stachelhaus code match:: 60% (weak)

AMP-binding (2027..2418): X

NRPSPredictor2: phe, trp, phg, tyr, bht

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: phe, trp, phg, tyr, bht
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAiTTGgVsK
Nearest Stachelhaus code:: tyr
Stachelhaus code match:: 70% (weak)

NZ_CP102267.1 - Region 8 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 2,164,991 - 2,185,560 nt. (total: 20,570 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.19	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.19	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.1	0.19	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000494.1	0.16	RiPP	uberolysin	Streptococcus uberis
BGC0000938.1	0.16	Other (Aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000802.1	0.16	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000509.1	0.15	RiPP	epilancin 15x	Staphylococcus epidermidis
BGC0000533.1	0.15	RiPP	mutacin III	Streptococcus mutans
BGC0000560.1	0.15	RiPP	subtilomycin	Bacillus subtilis
BGC0000530.1	0.15	RiPP	mutacin B-Ny266	Streptococcus mutans N66

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.51	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.51	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001407.1	0.50	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000494.1	0.47	RiPP	uberolysin	Streptococcus uberis
BGC0000938.1	0.46	Other (Aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000802.1	0.46	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000509.1	0.45	RiPP	epilancin 15x	Staphylococcus epidermidis
BGC0000533.1	0.45	RiPP	mutacin III	Streptococcus mutans
BGC0000560.1	0.45	RiPP	subtilomycin	Bacillus subtilis
BGC0000530.1	0.45	RiPP	mutacin B-Ny266	Streptococcus mutans N66

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 9 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 2,189,388 - 2,211,015 nt. (total: 21,628 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001723.1	0.25	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000248.1	0.25	Polyketide	naphtocyclinone	Streptomyces arenae
BGC0000275.1	0.22	Polyketide	tetracenomycin C	Streptomyces glaucescens
BGC0000228.1	0.22	Polyketide	granaticin	Streptomyces violaceoruber
BGC0000219.1	0.21	Polyketide, Saccharide	elloramycin	Streptomyces olivaceus
BGC0000231.1	0.21	Polyketide	griseusin	Streptomyces griseus
BGC0000272.1	0.21	Polyketide	spore pigment	Streptomyces collinus
BGC0002000.1	0.20	Polyketide	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000194.1	0.20	Polyketide	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001897.1	0.19	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001723.1	0.59	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000248.1	0.58	Polyketide	naphtocyclinone	Streptomyces arenae
BGC0000275.1	0.56	Polyketide	tetracenomycin C	Streptomyces glaucescens
BGC0000228.1	0.55	Polyketide	granaticin	Streptomyces violaceoruber
BGC0000219.1	0.53	Polyketide, Saccharide	elloramycin	Streptomyces olivaceus
BGC0000231.1	0.53	Polyketide	griseusin	Streptomyces griseus
BGC0000272.1	0.53	Polyketide	spore pigment	Streptomyces collinus
BGC0002000.1	0.52	Polyketide	setomimycin	Streptomyces aurantiacus JA 4570
BGC0000194.1	0.52	Polyketide	actinorhodin	Streptomyces coelicolor A3(2)
BGC0001897.1	0.52	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_1965 - Putative Class II

ctg1_1962 leader / core peptide: MKTCSERNEQRINSLQLSESLEDEIKELDGKNVEAGDVIFT - DhbDDhbDhaDhaFLDhbIVCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_1962 - Class II

Cleavage pHMM score: -4.00

RODEO score: 0

Monoisotopic mass: 1198.6 Da

Molecular weight: 1199.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 1217.4 Da N = 1; 1235.4 Da N = 2; 1253.4 Da N = 3

NZ_CP102267.1 - Region 10 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 2,715,265 - 2,736,853 nt. (total: 21,589 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.1	0.17	Other	nucleocidin	Streptomyces calvus
BGC0000501.1	0.16	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000552.1	0.16	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001391.1	0.15	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000497.1	0.15	RiPP	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000622.1	0.14	RiPP	megacin	Bacillus megaterium
BGC0000548.1	0.13	RiPP	salivaricin A	Streptococcus salivarius
BGC0000294.1	0.13	NRP	acinetobactin	Acinetobacter baumannii
BGC0000488.1	0.13	RiPP	circularin A	Clostridium beijerinckii
BGC0001891.1	0.13	Other	closthioamide	Ruminiclostridium cellulolyticum H10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.1	0.48	Other	nucleocidin	Streptomyces calvus
BGC0000501.1	0.46	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000552.1	0.46	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001391.1	0.46	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0000497.1	0.45	RiPP	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000622.1	0.44	RiPP	megacin	Bacillus megaterium
BGC0000548.1	0.42	RiPP	salivaricin A	Streptococcus salivarius
BGC0000294.1	0.42	NRP	acinetobactin	Acinetobacter baumannii
BGC0000488.1	0.42	RiPP	circularin A	Clostridium beijerinckii
BGC0001891.1	0.41	Other	closthioamide	Ruminiclostridium cellulolyticum H10

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP102267.1 - Region 11 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 3,300,589 - 3,323,282 nt. (total: 22,694 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.24	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.1	0.22	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000525.1	0.18	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000516.1	0.17	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000548.1	0.16	RiPP	salivaricin A	Streptococcus salivarius
BGC0000539.1	0.16	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000501.1	0.16	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000504.1	0.16	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000551.1	0.16	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000519.1	0.15	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.58	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000554.1	0.54	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000525.1	0.49	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000516.1	0.48	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000548.1	0.47	RiPP	salivaricin A	Streptococcus salivarius
BGC0000539.1	0.47	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000501.1	0.46	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000504.1	0.46	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000551.1	0.46	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000519.1	0.46	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_2988 - Putative Class II

ctg1_2989 leader / core peptide: MNEMNDKIIGNVEKELDEIEIIDTESIEEKLSFIVYG - DhbIVCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_2989 - Class II: Cleavage pHMM score: -5.90; RODEO score: 0; Monoisotopic mass: 519.2 Da; Molecular weight: 519.7 Da; Number of bridges: 1