GCF_033342255.1_ASM3334225v1_genomic - 11 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

c00018_NZ_JAWO.. (original name was: NZ_JAWONS010000096.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	cyclic-lactone-autoinducer	1	16,795

c00019_NZ_JAWO.. (original name was: NZ_JAWONS010000099.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 19.1	NRPS,cyclic-lactone-autoinducer	1	51,106

c00025_NZ_JAWO.. (original name was: NZ_JAWONS010000123.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	cyclic-lactone-autoinducer	60,626	80,173

c00030_NZ_JAWO.. (original name was: NZ_JAWONS010000133.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 30.1	lanthipeptide-class-ii,cyclic-lactone-autoinducer	37,279	67,555

c00034_NZ_JAWO.. (original name was: NZ_JAWONS010000167.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 34.1	resorcinol,cyclic-lactone-autoinducer	36,680	75,260	yersiniabactin	NRP + Polyketide	5%

c00045_NZ_JAWO.. (original name was: NZ_JAWONS010000240.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 45.1	cyclic-lactone-autoinducer	86,905	107,656

c00049_NZ_JAWO.. (original name was: NZ_JAWONS010000252.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 49.1	cyclic-lactone-autoinducer	58,210	81,673

c00053_NZ_JAWO.. (original name was: NZ_JAWONS010000280.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	ranthipeptide	20,229	41,623

c00056_NZ_JAWO.. (original name was: NZ_JAWONS010000290.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 56.1	RRE-containing	60,297	80,587
Region 56.2	RiPP-like	148,843	161,002

c00067_NZ_JAWO.. (original name was: NZ_JAWONS010000329.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 67.1	transAT-PKS,PKS-like,cyclic-lactone-autoinducer	75,331	170,593	kalimantacin A	NRP + Polyketide:Modular type I + Polyketide:Trans-AT type I	10%

Region	Type	From	To	Most similar known cluster	Similarity
Region 18.1	cyclic-lactone-autoinducer	1	16,795
Region 19.1	NRPS,cyclic-lactone-autoinducer	1	51,106
Region 25.1	cyclic-lactone-autoinducer	60,626	80,173
Region 30.1	lanthipeptide-class-ii,cyclic-lactone-autoinducer	37,279	67,555
Region 34.1	resorcinol,cyclic-lactone-autoinducer	36,680	75,260	yersiniabactin	NRP + Polyketide	5%
Region 45.1	cyclic-lactone-autoinducer	86,905	107,656
Region 49.1	cyclic-lactone-autoinducer	58,210	81,673
Region 53.1	ranthipeptide	20,229	41,623
Region 56.1	RRE-containing	60,297	80,587
Region 56.2	RiPP-like	148,843	161,002
Region 67.1	transAT-PKS,PKS-like,cyclic-lactone-autoinducer	75,331	170,593	kalimantacin A	NRP + Polyketide:Modular type I + Polyketide:Trans-AT type I	10%

No secondary metabolite regions were found in these records:: c00001_NZ_JAWO.. (original name was: NZ_JAWONS010000002.1); c00002_NZ_JAWO.. (original name was: NZ_JAWONS010000011.1); c00003_NZ_JAWO.. (original name was: NZ_JAWONS010000012.1); c00004_NZ_JAWO.. (original name was: NZ_JAWONS010000021.1); c00005_NZ_JAWO.. (original name was: NZ_JAWONS010000026.1); c00006_NZ_JAWO.. (original name was: NZ_JAWONS010000030.1); c00007_NZ_JAWO.. (original name was: NZ_JAWONS010000037.1); c00008_NZ_JAWO.. (original name was: NZ_JAWONS010000044.1); c00009_NZ_JAWO.. (original name was: NZ_JAWONS010000045.1); c00010_NZ_JAWO.. (original name was: NZ_JAWONS010000049.1); c00011_NZ_JAWO.. (original name was: NZ_JAWONS010000058.1); c00012_NZ_JAWO.. (original name was: NZ_JAWONS010000064.1); c00013_NZ_JAWO.. (original name was: NZ_JAWONS010000068.1); c00014_NZ_JAWO.. (original name was: NZ_JAWONS010000079.1); c00015_NZ_JAWO.. (original name was: NZ_JAWONS010000089.1); c00016_NZ_JAWO.. (original name was: NZ_JAWONS010000090.1); c00017_NZ_JAWO.. (original name was: NZ_JAWONS010000091.1); c00020_NZ_JAWO.. (original name was: NZ_JAWONS010000102.1); c00021_NZ_JAWO.. (original name was: NZ_JAWONS010000103.1); c00022_NZ_JAWO.. (original name was: NZ_JAWONS010000107.1); c00023_NZ_JAWO.. (original name was: NZ_JAWONS010000109.1); c00024_NZ_JAWO.. (original name was: NZ_JAWONS010000121.1); c00026_NZ_JAWO.. (original name was: NZ_JAWONS010000124.1); c00027_NZ_JAWO.. (original name was: NZ_JAWONS010000126.1); c00028_NZ_JAWO.. (original name was: NZ_JAWONS010000130.1); c00029_NZ_JAWO.. (original name was: NZ_JAWONS010000131.1); c00031_NZ_JAWO.. (original name was: NZ_JAWONS010000138.1); c00032_NZ_JAWO.. (original name was: NZ_JAWONS010000148.1); c00033_NZ_JAWO.. (original name was: NZ_JAWONS010000165.1); c00035_NZ_JAWO.. (original name was: NZ_JAWONS010000177.1); c00036_NZ_JAWO.. (original name was: NZ_JAWONS010000179.1); c00037_NZ_JAWO.. (original name was: NZ_JAWONS010000184.1); c00038_NZ_JAWO.. (original name was: NZ_JAWONS010000186.1); c00039_NZ_JAWO.. (original name was: NZ_JAWONS010000206.1); c00040_NZ_JAWO.. (original name was: NZ_JAWONS010000216.1); c00041_NZ_JAWO.. (original name was: NZ_JAWONS010000218.1); c00042_NZ_JAWO.. (original name was: NZ_JAWONS010000221.1); c00043_NZ_JAWO.. (original name was: NZ_JAWONS010000222.1); c00044_NZ_JAWO.. (original name was: NZ_JAWONS010000238.1); c00046_NZ_JAWO.. (original name was: NZ_JAWONS010000244.1); c00047_NZ_JAWO.. (original name was: NZ_JAWONS010000245.1); c00048_NZ_JAWO.. (original name was: NZ_JAWONS010000248.1); c00050_NZ_JAWO.. (original name was: NZ_JAWONS010000275.1); c00051_NZ_JAWO.. (original name was: NZ_JAWONS010000278.1); c00052_NZ_JAWO.. (original name was: NZ_JAWONS010000279.1); c00054_NZ_JAWO.. (original name was: NZ_JAWONS010000285.1); c00055_NZ_JAWO.. (original name was: NZ_JAWONS010000286.1); c00057_NZ_JAWO.. (original name was: NZ_JAWONS010000291.1); c00058_NZ_JAWO.. (original name was: NZ_JAWONS010000292.1); c00059_NZ_JAWO.. (original name was: NZ_JAWONS010000306.1); c00060_NZ_JAWO.. (original name was: NZ_JAWONS010000309.1); c00061_NZ_JAWO.. (original name was: NZ_JAWONS010000316.1); c00062_NZ_JAWO.. (original name was: NZ_JAWONS010000317.1); c00063_NZ_JAWO.. (original name was: NZ_JAWONS010000319.1); c00064_NZ_JAWO.. (original name was: NZ_JAWONS010000320.1); c00065_NZ_JAWO.. (original name was: NZ_JAWONS010000324.1); c00066_NZ_JAWO.. (original name was: NZ_JAWONS010000326.1); c00068_NZ_JAWO.. (original name was: NZ_JAWONS010000331.1)

Compact view

c00018_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1 - 16,795 nt. (total: 16,795 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.1	0.18	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.1	0.18	Other	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001120.1	0.16	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000249.1	0.16	Polyketide	nogalamycin	Streptomyces nogalater
BGC0001925.1	0.15	Alkaloid	altemicidin, SB-203207, SB-203208	Streptomyces sp.
BGC0000774.1	0.14	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0001098.1	0.10	NRP, Polyketide	iturin	Bacillus subtilis
BGC0001090.1	0.09	NRP, Polyketide	bacillomycin D	Bacillus velezensis FZB42
BGC0000864.1	0.06	Other	eicosapentaenoic acid-like compound	Moritella marina ATCC 15381
BGC0001941.1	0.05	NRP, Polyketide	fulvuthiacene A, fulvuthiacene B	Myxococcus fulvus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000866.1	0.50	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000867.1	0.50	Other	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0001120.1	0.47	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000249.1	0.47	Polyketide	nogalamycin	Streptomyces nogalater
BGC0001925.1	0.44	Alkaloid	altemicidin, SB-203207, SB-203208	Streptomyces sp.
BGC0000774.1	0.44	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0001098.1	0.35	NRP, Polyketide	iturin	Bacillus subtilis
BGC0001090.1	0.34	NRP, Polyketide	bacillomycin D	Bacillus velezensis FZB42
BGC0000864.1	0.25	Other	eicosapentaenoic acid-like compound	Moritella marina ATCC 15381
BGC0001941.1	0.22	NRP, Polyketide	fulvuthiacene A, fulvuthiacene B	Myxococcus fulvus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00019_NZ_JAWO.. - Region 1 - NRPS,cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1 - 51,106 nt. (total: 51,106 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.1	0.31	NRP	sevadicin	Paenibacillus larvae
BGC0001399.1	0.31	NRP	fellutamide B	Aspergillus nidulans FGSC A4
BGC0001767.1	0.30	NRP	salinichelins	Salinispora pacifica CNY331
BGC0001686.1	0.30	NRP	N-octanoyl-Met-Phe-H	Clostridium sp. CAG:567
BGC0000349.1	0.30	NRP	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001833.1	0.29	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000396.1	0.29	NRP	nodularin	Nostoc sp. 73.1
BGC0000389.1	0.29	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0001135.1	0.28	NRP	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001479.1	0.28	NRP	anabaenopeptin NZ857, nostamide A	Nostoc punctiforme PCC 73102

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000426.1	0.64	NRP	sevadicin	Paenibacillus larvae
BGC0001399.1	0.64	NRP	fellutamide B	Aspergillus nidulans FGSC A4
BGC0001767.1	0.64	NRP	salinichelins	Salinispora pacifica CNY331
BGC0001686.1	0.64	NRP	N-octanoyl-Met-Phe-H	Clostridium sp. CAG:567
BGC0000349.1	0.63	NRP	erythrochelin	Saccharopolyspora erythraea NRRL 2338
BGC0001833.1	0.63	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000396.1	0.63	NRP	nodularin	Nostoc sp. 73.1
BGC0000389.1	0.63	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0001135.1	0.62	NRP	bicornutin A1, bicornutin A2	Xenorhabdus budapestensis
BGC0001479.1	0.62	NRP	anabaenopeptin NZ857, nostamide A	Nostoc punctiforme PCC 73102

Similar known gene clusters

No matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 51106:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-X - X) + (X - glu - glu - X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg19_8

Search NORINE for peptide: strict or relaxed

AMP-binding (472..862): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlVgAViK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

AMP-binding (1981..2371): X

NRPSPredictor2: hydrophobic-aliphatic

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWlVgAViK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 70% (weak)

ctg19_10

Search NORINE for peptide: strict or relaxed

AMP-binding (472..862): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwLIGAViK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 80% (moderate)

AMP-binding (1504..1907): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDvGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (2549..2952): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAKDvGVVDK
Nearest Stachelhaus code:: glu
Stachelhaus code match:: 90% (moderate)

AMP-binding (3594..3982): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAWLIGAIiK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 90% (moderate)

c00025_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 60,626 - 80,173 nt. (total: 19,548 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000294.1	0.16	NRP	acinetobactin	Acinetobacter baumannii
BGC0000540.1	0.10	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000472.1	0.09	RiPP	anacyclamide A10	Anabaena sp. 90
BGC0000565.1	0.06	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000624.1	0.05	RiPP	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0001653.1	0.05	Polyketide	linfuranone B, linfuranone C	Microbispora sp. GMKU363
BGC0000203.1	0.03	Polyketide	BE-7585A	Amycolatopsis orientalis subsp. vinearia

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000294.1	0.46	NRP	acinetobactin	Acinetobacter baumannii
BGC0000540.1	0.37	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000472.1	0.33	RiPP	anacyclamide A10	Anabaena sp. 90
BGC0000565.1	0.27	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000624.1	0.23	RiPP	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0001653.1	0.22	Polyketide	linfuranone B, linfuranone C	Microbispora sp. GMKU363
BGC0000203.1	0.17	Polyketide	BE-7585A	Amycolatopsis orientalis subsp. vinearia

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00030_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 37,279 - 67,555 nt. (total: 30,277 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.70	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001579.1	0.69	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000503.1	0.63	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0000539.1	0.62	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000547.1	0.60	RiPP	salivaricin 9	Streptococcus salivarius
BGC0001787.1	0.59	RiPP	suicin 3908	Streptococcus suis
BGC0000498.1	0.54	RiPP	bovicin HJ50	Streptococcus equinus
BGC0000561.1	0.54	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000500.1	0.53	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000525.1	0.52	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.68	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001579.1	0.68	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000503.1	0.66	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0000539.1	0.64	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000547.1	0.63	RiPP	salivaricin 9	Streptococcus salivarius
BGC0001787.1	0.63	RiPP	suicin 3908	Streptococcus suis
BGC0000498.1	0.61	RiPP	bovicin HJ50	Streptococcus equinus
BGC0000561.1	0.61	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000500.1	0.60	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000557.1	0.60	RiPP	streptococcin A-FF22	Streptococcus pyogenes

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg30_51 - Putative Class II

ctg30_50 leader / core peptide: MNNMRNAVKRINFINPVGNVMKEMEEAELNRVSAG - AGVLRMDhaGGVVCDhbADhbAECYYGDhbYLKRCCPK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg30_50 - Class II: Cleavage pHMM score: -2.80; RODEO score: 0; Monoisotopic mass: 3081.5 Da; Molecular weight: 3083.7 Da; Number of bridges: 3; Additional modifications: AviCys

c00034_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer,resorcinol

Download region GenBank file

Download region SVG

Location: 36,680 - 75,260 nt. (total: 38,581 nt) Show pHMM detection rules used

Region on contig edge.

resorcinol: DarB
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001810.1	0.30	Polyketide	trehangelin	Polymorphospora rubra
BGC0001150.1	0.29	Polyketide	pamamycin-607	Streptomyces alboniger
BGC0000813.1	0.27	Alkaloid	K-252a	Nonomuraea longicatena
BGC0000898.1	0.27	Saccharide	desosamine	Streptomyces venezuelae
BGC0000025.1	0.27	Polyketide	avermectin	Streptomyces avermitilis
BGC0000794.1	0.27	Saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0000773.1	0.27	Saccharide	lipopolysaccharide	Escherichia coli
BGC0000790.1	0.27	Saccharide	O-antigen	Escherichia coli
BGC0000795.1	0.27	Saccharide	S-layer glycan	Aneurinibacillus thermoaerophilus
BGC0000791.1	0.27	Saccharide	O-antigen	Cronobacter sakazakii

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000813.1	0.61	Alkaloid	K-252a	Nonomuraea longicatena
BGC0000245.1	0.60	Polyketide	medermycin	Streptomyces sp. AM-7161
BGC0000825.1	0.59	Alkaloid	staurosporine	Streptomyces sp. TP-A0274
BGC0000880.1	0.57	Other (Nucleoside)	tunicamycin B1	Streptomyces chartreusis NRRL 3882
BGC0001960.1	0.56	Polyketide	hiroshidine	Streptomyces hiroshimensis
BGC0000261.1	0.55	Polyketide	R1128	Streptomyces sp. R1128
BGC0001730.1	0.55	Polyketide	paramagnetoquinone 1, paramagnetoquinone 2	Actinoallomurus sp.
BGC0000272.1	0.54	Polyketide	spore pigment	Streptomyces collinus
BGC0000253.1	0.53	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0001513.1	0.53	Polyketide	anthrabenzoxocinone	Actinobacteria bacterium

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00045_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 86,905 - 107,656 nt. (total: 20,752 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.1	0.20	RiPP	circularin A	Clostridium beijerinckii
BGC0000896.1	0.17	Other	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000496.1	0.17	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000542.1	0.16	RiPP	paenicidin B	Paenibacillus terrae
BGC0000551.1	0.16	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000517.1	0.16	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000519.1	0.16	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000774.1	0.16	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0000552.1	0.16	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001391.1	0.16	RiPP	thusin	Bacillus thuringiensis serovar rongseni

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.1	0.52	RiPP	circularin A	Clostridium beijerinckii
BGC0000896.1	0.48	Other	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000496.1	0.48	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000542.1	0.47	RiPP	paenicidin B	Paenibacillus terrae
BGC0000551.1	0.47	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000517.1	0.47	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000519.1	0.46	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000774.1	0.46	Saccharide	lipopolysaccharide	Xanthomonas campestris pv. campestris
BGC0000552.1	0.46	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001391.1	0.46	RiPP	thusin	Bacillus thuringiensis serovar rongseni

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00049_NZ_JAWO.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 58,210 - 81,673 nt. (total: 23,464 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001323.1	0.15	Terpene	monoterpenes-diterpenes	Solanum pennellii
BGC0001235.1	0.14	NRP, Polyketide	antalid	Polyangium spumosum
BGC0001484.1	0.13	Other	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0001321.1	0.12	Terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001324.1	0.09	Terpene	monoterpenes-diterpenes	Solanum pimpinellifolium
BGC0001322.1	0.09	Terpene	lycosantalonol	Solanum lycopersicum
BGC0001078.1	0.08	Terpene, Polyketide	furaquinocin B	Streptomyces sp. KO-3988
BGC0001406.1	0.06	NRP	telomycin	Streptomyces canus
BGC0000291.1	0.05	NRP	A54145	Streptomyces fradiae
BGC0000974.1	0.05	NRP, Polyketide	crocacin	Chondromyces crocatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001323.1	0.45	Terpene	monoterpenes-diterpenes	Solanum pennellii
BGC0001235.1	0.43	NRP, Polyketide	antalid	Polyangium spumosum
BGC0001484.1	0.42	Other	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365
BGC0001321.1	0.39	Terpene	monoterpenes-diterpenes	Solanum habrochaites
BGC0001324.1	0.34	Terpene	monoterpenes-diterpenes	Solanum pimpinellifolium
BGC0001322.1	0.34	Terpene	lycosantalonol	Solanum lycopersicum
BGC0001078.1	0.30	Terpene, Polyketide	furaquinocin B	Streptomyces sp. KO-3988
BGC0001406.1	0.26	NRP	telomycin	Streptomyces canus
BGC0000291.1	0.23	NRP	A54145	Streptomyces fradiae
BGC0000974.1	0.21	NRP, Polyketide	crocacin	Chondromyces crocatus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00053_NZ_JAWO.. - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 20,229 - 41,623 nt. (total: 21,395 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.17	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000231.1	0.17	Polyketide	griseusin	Streptomyces griseus
BGC0000888.1	0.17	Other	bacilysin	Bacillus sp. CS93
BGC0000797.1	0.16	Saccharide	sphingan polysaccharide	Sphingomonas sp. S88
BGC0000886.1	0.16	Other	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0000794.1	0.16	Saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0001894.1	0.16	Saccharide	heteropolysaccharide (HePS)	Lactobacillus plantarum
BGC0000768.1	0.16	Saccharide	gellan polysaccharide	Sphingomonas elodea ATCC 31461
BGC0000730.1	0.16	Saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000731.1	0.16	Saccharide	capsular polysaccharide	Klebsiella pneumoniae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.48	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000231.1	0.48	Polyketide	griseusin	Streptomyces griseus
BGC0000888.1	0.48	Other	bacilysin	Bacillus sp. CS93
BGC0000797.1	0.47	Saccharide	sphingan polysaccharide	Sphingomonas sp. S88
BGC0000886.1	0.47	Other	allylmalonyl-CoA	Streptomyces tsukubensis
BGC0000794.1	0.47	Saccharide	S-layer glycan	Geobacillus stearothermophilus
BGC0001894.1	0.47	Saccharide	heteropolysaccharide (HePS)	Lactobacillus plantarum
BGC0000768.1	0.46	Saccharide	gellan polysaccharide	Sphingomonas elodea ATCC 31461
BGC0000730.1	0.46	Saccharide	capsular polysaccharide	Klebsiella pneumoniae
BGC0000731.1	0.46	Saccharide	capsular polysaccharide	Klebsiella pneumoniae

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00056_NZ_JAWO.. - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 60,297 - 80,587 nt. (total: 20,291 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000904.1	0.21	Other	FR-900098	Streptomyces rubellomurinus
BGC0001859.1	0.20	Other (Phosphonate)	fosfomycin	Pseudomonas syringae
BGC0000386.1	0.13	NRP	malleobactin A, malleobactin B, malleobactin C, malleobactin D	Burkholderia thailandensis E264
BGC0000486.1	0.09	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001277.1	0.08	Terpene	nivalenol, vomitoxin, 3-acetyldeoxynivalenol, 15-acetyldeoxynivalenol, neosolaniol, calonectrin, apotrichodiol, isotrichotriol, 15-deacetylcalonectrin, T-2 toxin, 3-acetyl T-2 toxin, trichodiene	Fusarium graminearum
BGC0001278.1	0.07	Terpene	nivalenol, deoxynivalenol, 3-acetyldeoxynivalenol, 15-acetyldeoxynivalenol, neosolaniol, calonectrin, apotrichodiol, isotrichotriol, 15-decalonectrin, T-2 toxin, 3-acetyl T-2 toxin, trichodiene	Fusarium sporotrichioides
BGC0001687.1	0.06	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0001053.1	0.04	NRP, Polyketide	tubulysin A	Archangium disciforme
BGC0001979.1	0.04	Polyketide	LL-D49194α1 (LLD)	Streptomyces vinaceusdrappus
BGC0000974.1	0.04	NRP, Polyketide	crocacin	Chondromyces crocatus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000904.1	0.54	Other	FR-900098	Streptomyces rubellomurinus
BGC0001859.1	0.53	Other (Phosphonate)	fosfomycin	Pseudomonas syringae
BGC0000386.1	0.42	NRP	malleobactin A, malleobactin B, malleobactin C, malleobactin D	Burkholderia thailandensis E264
BGC0000486.1	0.33	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001277.1	0.30	Terpene	nivalenol, vomitoxin, 3-acetyldeoxynivalenol, 15-acetyldeoxynivalenol, neosolaniol, calonectrin, apotrichodiol, isotrichotriol, 15-deacetylcalonectrin, T-2 toxin, 3-acetyl T-2 toxin, trichodiene	Fusarium graminearum
BGC0001278.1	0.28	Terpene	nivalenol, deoxynivalenol, 3-acetyldeoxynivalenol, 15-acetyldeoxynivalenol, neosolaniol, calonectrin, apotrichodiol, isotrichotriol, 15-decalonectrin, T-2 toxin, 3-acetyl T-2 toxin, trichodiene	Fusarium sporotrichioides
BGC0001687.1	0.26	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSL12
BGC0001053.1	0.20	NRP, Polyketide	tubulysin A	Archangium disciforme
BGC0001979.1	0.18	Polyketide	LL-D49194α1 (LLD)	Streptomyces vinaceusdrappus
BGC0000974.1	0.17	NRP, Polyketide	crocacin	Chondromyces crocatus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00056_NZ_JAWO.. - Region 2 - RiPP-like

Download region GenBank file

Download region SVG

Location: 148,843 - 161,002 nt. (total: 12,160 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.1	0.23	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000554.1	0.21	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.1	0.21	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.21	RiPP	pallidocin	Aeribacillus pallidus
BGC0001863.1	0.21	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001861.1	0.20	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000504.1	0.19	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.19	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.1	0.18	RiPP	coagulin	Bacillus coagulans
BGC0000516.1	0.18	RiPP	geobacillin II	Geobacillus thermodenitrificans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.1	0.56	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000554.1	0.54	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001862.1	0.54	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.54	RiPP	pallidocin	Aeribacillus pallidus
BGC0001863.1	0.53	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001861.1	0.53	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000504.1	0.51	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.51	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.1	0.50	RiPP	coagulin	Bacillus coagulans
BGC0000516.1	0.49	RiPP	geobacillin II	Geobacillus thermodenitrificans

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00067_NZ_JAWO.. - Region 1 - PKS-like,cyclic-lactone-autoinducer,transAT-PKS

Download region GenBank file

Download region SVG

Location: 75,331 - 170,593 nt. (total: 95,263 nt) Show pHMM detection rules used

transAT-PKS: (cds(PKS_AT and not (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) and (cds(ATd and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS)) or cds(tra_KS and PP-binding)))
PKS-like: (t2pks2 or ksIII)
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000205.1	0.73	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0000234.1	0.73	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000253.1	0.60	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000261.1	0.55	Polyketide	R1128	Streptomyces sp. R1128
BGC0001730.1	0.53	Polyketide	paramagnetoquinone 1, paramagnetoquinone 2	Actinoallomurus sp.
BGC0001258.1	0.50	Polyketide	1,3,6,8-tetrahydroxynaphthalene	Glarea lozoyensis
BGC0000223.1	0.48	Polyketide	rabelomycin, dehydrorabelomycin, fluostatin F, fluostatin G, fluostatin H	uncultured bacterium BAC AB649/1850
BGC0000979.1	0.48	NRP, Polyketide	cylindrospermopsin	Aphanizomenon sp. 10E9
BGC0000980.1	0.48	NRP, Polyketide	cylindrospermopsin	Aphanizomenon sp. 22D11
BGC0000043.1	0.47	Polyketide	curacin A	Moorea producens 19L

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000174.1	0.60	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0000234.1	0.60	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000205.1	0.59	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0002008.1	0.58	Other	aryl polyenes	Xenorhabdus doucetiae
BGC0001163.1	0.58	Polyketide	1-heptadecene	Moorea producens 3L
BGC0000180.1	0.58	Polyketide	legioliulin	Legionella parisiensis
BGC0000263.1	0.57	Polyketide	ravidomycin	Streptomyces ravidus
BGC0000836.1	0.57	Other	APE Ec	Escherichia coli CFT073
BGC0000223.1	0.57	Polyketide	rabelomycin, dehydrorabelomycin, fluostatin F, fluostatin G, fluostatin H	uncultured bacterium BAC AB649/1850
BGC0000258.1	0.56	Polyketide	prodigiosin	Serratia sp.

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 75330 - 170593:

Rough prediction of core scaffold based on assumed PKS linker matching; tailoring reactions not taken into account

Polymer prediction:: (mal - ccmal - ohmal - ohmal) + (mal - mal - ohmal - mal) + (ccmal - ccmal - ohmal - mal) + (ccmal - mal - mal)
Non-colinear ordering:: ctg67_90 + ctg67_91 + ctg67_92 + ctg67_89 + ctg67_103 + ctg67_100 + ctg67_101

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg67_93

CAL_domain (165..468): pk

minowa: fatty_acid

Prediction, score:

fatty_acid: 90.0
NH2: 14.8
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

ctg67_101

PKS_AT (4..280): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 83.3%; inactive: 75.0%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 93.7
inactive: 38.8
Methoxymalonyl-CoA: 22.8
Methylmalonyl-CoA: 17.7
Propionyl-CoA: 15.2
fatty_acid: 9.0
trans-1,2-CPDA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0

ctg67_103

PKS_AT (7..290): pk

ATSignature: (unknown)

No matches above 50%

minowa: inactive

Prediction, score:

inactive: 18.4
Malonyl-CoA: 9.7
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Propionyl-CoA: 0.0
Methylmalonyl-CoA: 0.0
Methoxymalonyl-CoA: 0.0
Isobutyryl-CoA: 0.0
Ethylmalonyl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0
2-Methylbutyryl-CoA: 0.0