GCF_000394055.1_Ente_cocc_BAA-1240_V1_genomic - 5 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KB946332.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	754,561	777,674

NZ_KB946333.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	lanthipeptide-class-ii	124,014	146,914

NZ_KB946334.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	ranthipeptide	170,799	192,240
Region 3.2	cyclic-lactone-autoinducer,lanthipeptide-class-ii	259,811	285,005	cytolysin ClyLl / cytolysin ClyLs	RiPP:Lanthipeptide	40%

NZ_KB946335.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 4.1	LAP	642,470	665,576	listeriolysin S	RiPP:LAP	75%

Region	Type	From	To	Most similar known cluster	Similarity
Region 1.1	lanthipeptide-class-ii	754,561	777,674
Region 2.1	lanthipeptide-class-ii	124,014	146,914
Region 3.1	ranthipeptide	170,799	192,240
Region 3.2	cyclic-lactone-autoinducer,lanthipeptide-class-ii	259,811	285,005	cytolysin ClyLl / cytolysin ClyLs	RiPP:Lanthipeptide	40%
Region 4.1	LAP	642,470	665,576	listeriolysin S	RiPP:LAP	75%

Compact view

NZ_KB946332.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 754,561 - 777,674 nt. (total: 23,114 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.32	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.29	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000504.1	0.25	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.1	0.24	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.1	0.23	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.1	0.20	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.1	0.20	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.1	0.20	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001229.1	0.19	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001311.1	0.17	RiPP	flavecins	Ruminococcus flavefaciens FD-1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.65	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.63	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000504.1	0.58	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001210.1	0.57	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000528.1	0.56	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.1	0.53	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000517.1	0.52	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000527.1	0.52	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0001229.1	0.50	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0001311.1	0.49	RiPP	flavecins	Ruminococcus flavefaciens FD-1

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptides - No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

No core peptides found.

NZ_KB946333.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 124,014 - 146,914 nt. (total: 22,901 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.18	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000502.1	0.15	RiPP	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001210.1	0.15	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001407.1	0.13	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000548.1	0.13	RiPP	salivaricin A	Streptococcus salivarius
BGC0000877.1	0.06	Other	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001057.1	0.05	NRP, Polyketide	zearalenone	Fusarium graminearum
BGC0001056.1	0.04	NRP, Polyketide	zeamine, zeamine I, zeamine II, prezeamine, prezeamine I	Serratia plymuthica RVH1
BGC0001281.1	0.04	Polyketide	ustilagic acid	Ustilago maydis 521
BGC0000806.1	0.04	Saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.49	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000502.1	0.45	RiPP	cerecidin, cerecidin A1, cerecidin A2, cerecidin A3, cerecidin A4, cerecidin A5, cerecidin A6, cerecidin A7	Bacillus cereus
BGC0001210.1	0.45	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001407.1	0.41	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000548.1	0.41	RiPP	salivaricin A	Streptococcus salivarius
BGC0000877.1	0.25	Other	polyoxin A, polyoxin H	Streptomyces cacaoi subsp. asoensis
BGC0001057.1	0.23	NRP, Polyketide	zearalenone	Fusarium graminearum
BGC0001056.1	0.21	NRP, Polyketide	zeamine, zeamine I, zeamine II, prezeamine, prezeamine I	Serratia plymuthica RVH1
BGC0001281.1	0.19	Polyketide	ustilagic acid	Ustilago maydis 521
BGC0000806.1	0.19	Saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg2_114 - Putative Class II

ctg2_115 leader / core peptide: MRKLSIEKMETAKDLKKVDSVVGA - DhaFERDhaKNDhaEEDhbVDRDhaEDhbIVANDhbIGGWDhaRIICLP
allorf_0131151_0131318 leader / core peptide: MFICDEPLARKQLVLRCVLQQFQLISERITSAAIVYS - DhbHFFNKYLDhbVGLPHDhaLCC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg2_115 - Class II

Cleavage pHMM score: -2.80

RODEO score: 0

Monoisotopic mass: 3549.8 Da

Molecular weight: 3551.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3569.9 Da N = 1; 3587.9 Da N = 2; 3606.0 Da N = 3; 3624.0 Da N = 4; 3642.0 Da N = 5; 3660.0 Da N = 6; 3678.0 Da N = 7

allorf_0131151_0131318 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 2025.0 Da

Molecular weight: 2026.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2044.4 Da N = 1

NZ_KB946334.1 - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 170,799 - 192,240 nt. (total: 21,442 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001929.1	0.30	RiPP	WGK	Streptococcus ferus
BGC0001364.1	0.16	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001510.1	0.15	Other	anisomycin	Streptomyces hygrospinosus
BGC0000469.1	0.12	RiPP	bottromycin A2	Streptomyces sp. BC16019
BGC0000691.1	0.11	Saccharide	acarbose	Actinoplanes sp. SE50/110
BGC0000804.1	0.11	Saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001728.1	0.08	NRP, Polyketide	paenilipoheptin	Paenibacillus polymyxa E681
BGC0001812.1	0.07	Polyketide	tylactone	Micromonospora chalcea subsp. izumensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001929.1	0.63	RiPP	WGK	Streptococcus ferus
BGC0001364.1	0.46	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001510.1	0.45	Other	anisomycin	Streptomyces hygrospinosus
BGC0000469.1	0.40	RiPP	bottromycin A2	Streptomyces sp. BC16019
BGC0000691.1	0.38	Saccharide	acarbose	Actinoplanes sp. SE50/110
BGC0000804.1	0.38	Saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001728.1	0.30	NRP, Polyketide	paenilipoheptin	Paenibacillus polymyxa E681
BGC0001812.1	0.29	Polyketide	tylactone	Micromonospora chalcea subsp. izumensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_KB946334.1 - Region 2 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 259,811 - 285,005 nt. (total: 25,195 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.84	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000554.1	0.63	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.54	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000525.1	0.50	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000540.1	0.46	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000528.1	0.46	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001229.1	0.45	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000558.1	0.45	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000539.1	0.45	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0001291.1	0.45	RiPP	enterocin NKR-5-3B	Enterococcus faecium

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.73	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000554.1	0.65	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.61	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000525.1	0.59	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000540.1	0.56	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000528.1	0.56	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001229.1	0.56	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000558.1	0.56	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000539.1	0.56	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0001291.1	0.55	RiPP	enterocin NKR-5-3B	Enterococcus faecium

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg3_243 - Putative Class II

ctg3_246 leader / core peptide: VEKIVGKAFEELTEEEMKKMQGS - GDVQPEDhbDhbPICGFDhbIGIGIGALADhaVKWC
ctg3_247 leader / core peptide: MEKIIGQSFEELSKKEMEAMQGS - GDVQAEDhbDhbPVCAIDhaADhbVAADhaDhaAACAGVGAGIGDhbGIDhbIVLDhbFKRC
ctg3_248 leader / core peptide: MEKIIGQSFEELSKKEMEAMQGS - GDVQVEDhbDhbPVCAIDhaADhbVAADhaDhaAACAGVGAGIGDhbGIDhbIVLDhbFKRC
ctg3_249 leader / core peptide: MEKIIGQSFEELSKKEMEAMQGS - GDVQAEDhbDhbPVCAIDhaADhbVAADhaDhaAACAGVGAGIGDhbGIDhbIVLDhbFKRC
ctg3_250 leader / core peptide: MEEIVGKAFEELTEEEMKNMQGS - GDVQPEDhbDhbPLCGFDhbIGIGIGALVDhaVKWC
allorf_270990_271106 leader / core peptide: VLPFFSITLEGYLERSTENGE - DRCAHDhbANFCCHEFKKN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg3_246 - Class II

Cleavage pHMM score: -0.30

RODEO score: 0

Monoisotopic mass: 2760.4 Da

Molecular weight: 2762.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2780.2 Da N = 1; 2798.2 Da N = 2

ctg3_247 - Class II

Cleavage pHMM score: 1.60

RODEO score: 0

Monoisotopic mass: 3975.1 Da

Molecular weight: 3977.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3995.6 Da N = 1; 4013.6 Da N = 2; 4031.6 Da N = 3; 4049.6 Da N = 4; 4067.6 Da N = 5; 4085.7 Da N = 6

ctg3_248 - Class II

Cleavage pHMM score: 1.60

RODEO score: 0

Monoisotopic mass: 4003.1 Da

Molecular weight: 4005.6 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4023.6 Da N = 1; 4041.6 Da N = 2; 4059.7 Da N = 3; 4077.7 Da N = 4; 4095.7 Da N = 5; 4113.7 Da N = 6

ctg3_249 - Class II

Cleavage pHMM score: 1.60

RODEO score: 0

Monoisotopic mass: 3975.1 Da

Molecular weight: 3977.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3995.6 Da N = 1; 4013.6 Da N = 2; 4031.6 Da N = 3; 4049.6 Da N = 4; 4067.6 Da N = 5; 4085.7 Da N = 6

ctg3_250 - Class II

Cleavage pHMM score: 1.10

RODEO score: 0

Monoisotopic mass: 2788.5 Da

Molecular weight: 2790.2 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2808.3 Da N = 1; 2826.3 Da N = 2

allorf_270990_271106 - Class II

Cleavage pHMM score: -6.20

RODEO score: 0

Monoisotopic mass: 2004.9 Da

Molecular weight: 2006.2 Da

Number of bridges: 1

NZ_KB946335.1 - Region 1 - LAP

Download region GenBank file

Download region SVG

Location: 642,470 - 665,576 nt. (total: 23,107 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001171.1	0.41	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000568.1	0.26	RiPP	microcin B17	Escherichia coli
BGC0000566.1	0.23	RiPP	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0002013.1	0.23	RiPP	curacozole	Streptomyces curacoi
BGC0000565.1	0.19	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000564.1	0.18	RiPP	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001170.1	0.18	RiPP	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000626.1	0.16	RiPP	thuricin	Bacillus thuringiensis
BGC0001356.1	0.16	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001645.1	0.16	RiPP	lagmysin	Streptomyces sp. NRRL S-118

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001171.1	0.73	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000568.1	0.60	RiPP	microcin B17	Escherichia coli
BGC0000566.1	0.56	RiPP	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0002013.1	0.56	RiPP	curacozole	Streptomyces curacoi
BGC0000565.1	0.51	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000564.1	0.49	RiPP	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0001170.1	0.49	RiPP	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000626.1	0.47	RiPP	thuricin	Bacillus thuringiensis
BGC0001356.1	0.47	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001645.1	0.47	RiPP	lagmysin	Streptomyces sp. NRRL S-118

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names