GCF_002074095.1_ASM207409v1_genomic - 10 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CP014842.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	353,029	379,990	lichenicidin VK21 A1 / lichenicidin VK21 A2	RiPP:Lanthipeptide	100%
Region 1.2	lassopeptide	438,975	461,436
Region 1.3	NRPS	564,393	610,317	bacillibactin	NRP	53%
Region 1.4	CDPS	888,304	909,053
Region 1.5	T3PKS	2,004,143	2,045,240
Region 1.6	terpene	2,094,581	2,116,470
Region 1.7	betalactone	2,212,862	2,241,376	fengycin	NRP	53%
Region 1.8	siderophore	3,032,453	3,047,919
Region 1.9	thiopeptide,RiPP-like	3,169,947	3,211,238	butirosin A / butirosin B	Saccharide	7%
Region 1.10	NRPS	3,810,402	3,875,851	lichenysin	NRP	100%

No secondary metabolite regions were found in these records:: NZ_CP014843.1

Compact view

NZ_CP014842.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 353,029 - 379,990 nt. (total: 26,962 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	1.00	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001229.1	0.34	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000517.1	0.34	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000539.1	0.30	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000523.1	0.29	RiPP	lactocin S	Lactobacillus sakei
BGC0000504.1	0.27	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001787.1	0.26	RiPP	suicin 3908	Streptococcus suis
BGC0001364.1	0.26	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000561.1	0.26	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000554.1	0.25	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	1.00	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001229.1	0.67	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000517.1	0.67	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000539.1	0.63	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000523.1	0.62	RiPP	lactocin S	Lactobacillus sakei
BGC0000504.1	0.61	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001787.1	0.60	RiPP	suicin 3908	Streptococcus suis
BGC0001364.1	0.60	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0000561.1	0.59	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000554.1	0.58	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_319 - Putative Class II

ctg1_320 leader / core peptide: MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG - DhbIDhbLDhaDhbCAILDhaKPLGNNGYLCDhbVDhbKECMPDhaCN
ctg1_321 leader / core peptide: MKTMKNSAAREAFKGANHPAGMVSEEELKALVGG - NDVNPEDhbDhbPADhbDhbDhaDhaWDhbCIDhbAGVDhbVDhaADhaLCPDhbDhbKCDhbDhaRC
allorf_0354436_0354504 leader / core peptide: MLNDEMFHVNFG - AFFDhaCCFDhaAC
allorf_0362763_0362888 leader / core peptide: LMPTLNGKRLQLRRILNGG - HRDhaDhaLPFIGIREDhaIACIDhaELDhaE
allorf_0353062_0353172 leader / core peptide: MDSKYAGS - LHKIVVDhbLKMEVQRCKVFIRFAGNLDIF

Lanthipeptide(s) for ctg1_322 - Putative Class II

ctg1_320 leader / core peptide: MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG - DhbIDhbLDhaDhbCAILDhaKPLGNNGYLCDhbVDhbKECMPDhaCN
ctg1_321 leader / core peptide: MKTMKNSAAREAFKGANHPAGMVSEEELKALVGG - NDVNPEDhbDhbPADhbDhbDhaDhaWDhbCIDhbAGVDhbVDhaADhaLCPDhbDhbKCDhbDhaRC
allorf_0362763_0362888 leader / core peptide: LMPTLNGKRLQLRRILNGG - HRDhaDhaLPFIGIREDhaIACIDhaELDhaE

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_320 - Class II

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 3230.6 Da

Molecular weight: 3232.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3250.8 Da N = 1; 3268.8 Da N = 2; 3286.9 Da N = 3; 3304.9 Da N = 4

ctg1_321 - Class II

Cleavage pHMM score: 1.50

RODEO score: 0

Monoisotopic mass: 3632.8 Da

Molecular weight: 3635.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3653.0 Da N = 1; 3671.1 Da N = 2; 3689.1 Da N = 3; 3707.1 Da N = 4; 3725.1 Da N = 5; 3743.1 Da N = 6; 3761.2 Da N = 7; 3779.2 Da N = 8; 3797.2 Da N = 9; 3815.2 Da N = 10; 3833.2 Da N = 11

allorf_0362763_0362888 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 2353.3 Da

Molecular weight: 2354.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2372.7 Da N = 1; 2390.7 Da N = 2; 2408.7 Da N = 3; 2426.7 Da N = 4

ctg1_320 - Class II

Cleavage pHMM score: 3.30

RODEO score: 0

Monoisotopic mass: 3230.6 Da

Molecular weight: 3232.8 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3250.8 Da N = 1; 3268.8 Da N = 2; 3286.9 Da N = 3; 3304.9 Da N = 4

ctg1_321 - Class II

Cleavage pHMM score: 1.50

RODEO score: 0

Monoisotopic mass: 3632.8 Da

Molecular weight: 3635.0 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 3653.0 Da N = 1; 3671.1 Da N = 2; 3689.1 Da N = 3; 3707.1 Da N = 4; 3725.1 Da N = 5; 3743.1 Da N = 6; 3761.2 Da N = 7; 3779.2 Da N = 8; 3797.2 Da N = 9; 3815.2 Da N = 10; 3833.2 Da N = 11

allorf_0354436_0354504 - Class II

Cleavage pHMM score: -4.30

RODEO score: 0

Monoisotopic mass: 1048.4 Da

Molecular weight: 1049.2 Da

Number of bridges: 2

allorf_0362763_0362888 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 2353.3 Da

Molecular weight: 2354.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2372.7 Da N = 1; 2390.7 Da N = 2; 2408.7 Da N = 3; 2426.7 Da N = 4

allorf_0353062_0353172 - Class II

Cleavage pHMM score: -7.20

RODEO score: 0

Monoisotopic mass: 3298.9 Da

Molecular weight: 3301.0 Da

Number of bridges: 1

NZ_CP014842.1 - Region 2 - lassopeptide

Download region GenBank file

Download region SVG

Location: 438,975 - 461,436 nt. (total: 22,462 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lasso peptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.1	0.30	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.1	0.29	RiPP	lariatin	Rhodococcus jostii
BGC0001549.1	0.29	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001552.1	0.29	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001496.1	0.28	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000571.1	0.28	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001889.1	0.27	RiPP	fusilassin	Thermobifida fusca YX
BGC0001645.1	0.26	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001356.1	0.26	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001551.1	0.25	RiPP	citrulassin E	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001634.1	0.64	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0000575.1	0.63	RiPP	lariatin	Rhodococcus jostii
BGC0001549.1	0.62	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001552.1	0.62	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001496.1	0.62	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000571.1	0.62	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001889.1	0.60	RiPP	fusilassin	Thermobifida fusca YX
BGC0001645.1	0.60	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001356.1	0.60	RiPP	paeninodin	Paenibacillus dendritiformis C454
BGC0001551.1	0.58	RiPP	citrulassin E	Streptomyces glaucescens

Similar known gene clusters

No matches found.

Lasso peptide predictions

Lassopeptide(s) for ctg1_408 - Putative Class II

ctg1_408 leader / core peptide / cleaved tail: MRKLESAQVKSYGSFLTVTL - SKKSKPGDGKFGRGVKRG

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

Core peptide predictions

ctg1_408 - Class II: Cleavage pHMM score: -6.40; RODEO score: 19; Monoisotopic mass: 1870.1 Da; Molecular weight: 1871.1 Da; Number of bridges: 0

NZ_CP014842.1 - Region 3 - NRPS

Download region GenBank file

Download region SVG

Location: 564,393 - 610,317 nt. (total: 45,925 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.1	0.56	NRP	bacillibactin	Bacillus velezensis FZB42
BGC0000401.1	0.55	NRP	paenibactin	Paenibacillus elgii B69
BGC0000309.1	0.35	NRP	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001615.1	0.34	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000457.1	0.31	NRP	vicibactin	Rhizobium etli CFN 42
BGC0001149.1	0.30	NRP, Saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001833.1	0.28	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.1	0.28	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000417.1	0.28	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001825.1	0.27	NRP	xenematide	Xenorhabdus nematophila AN6/1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001185.1	0.82	NRP	bacillibactin	Bacillus velezensis FZB42
BGC0000401.1	0.82	NRP	paenibactin	Paenibacillus elgii B69
BGC0000309.1	0.68	NRP	bacillibactin	Bacillus subtilis subsp. subtilis str. 168
BGC0001615.1	0.67	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000457.1	0.65	NRP	vicibactin	Rhizobium etli CFN 42
BGC0001149.1	0.64	NRP, Saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001833.1	0.61	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001132.1	0.61	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000417.1	0.61	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001825.1	0.61	NRP	xenematide	Xenorhabdus nematophila AN6/1

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 3, location 564392 - 610317:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gly - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_544

Search NORINE for peptide: strict or relaxed

AMP-binding (31..435): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPgQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)

ctg1_546

Search NORINE for peptide: strict or relaxed

AMP-binding (465..861): gly

NRPSPredictor2: gly

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: gly, ala
Single AA prediction:: gly

Stachelhaus prediction details:

Stachelhaus sequence:: DILQLGLIWK
Nearest Stachelhaus code:: gly
Stachelhaus code match:: 100% (strong)

AMP-binding (1521..1937): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNIGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

NZ_CP014842.1 - Region 4 - CDPS

Download region GenBank file

Download region SVG

Location: 888,304 - 909,053 nt. (total: 20,750 nt) Show pHMM detection rules used

CDPS: (CDPS or cycdipepsynth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.1	0.21	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.21	Other	bacilysin	Bacillus sp. CS93
BGC0001514.1	0.16	Other	aristeromycin	Streptomyces citricolor
BGC0000719.1	0.16	Saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.1	0.15	Saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000622.1	0.14	RiPP	megacin	Bacillus megaterium
BGC0001782.1	0.14	Other	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001140.1	0.13	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0001335.1	0.13	Alkaloid	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000866.1	0.13	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001184.1	0.54	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.54	Other	bacilysin	Bacillus sp. CS93
BGC0001514.1	0.46	Other	aristeromycin	Streptomyces citricolor
BGC0000719.1	0.46	Saccharide	tobramycin	Streptoalloteichus hindustanus
BGC0000720.1	0.45	Saccharide	tobramycin	Streptoalloteichus tenebrarius
BGC0000622.1	0.44	RiPP	megacin	Bacillus megaterium
BGC0001782.1	0.43	Other	spiroindimicin A, spiroindimicin B, spiroindimicin C, spiroindimicin D, indimicin A, indimicin B, indimicin C, indimicin D, indimicin E, lynamicin A, lynamicin D, lynamicin F, lynamicin G	Streptomyces sp. SCSIO 03032
BGC0001140.1	0.42	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0001335.1	0.42	Alkaloid	borregomycin A, borregomycin B, borregomycin C, borregomycin D	uncultured bacterium
BGC0000866.1	0.42	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP014842.1 - Region 5 - T3PKS

Download region GenBank file

Download region SVG

Location: 2,004,143 - 2,045,240 nt. (total: 41,098 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.1	0.36	Polyketide	alkylresorcinol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.1	0.20	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001475.1	0.17	Polyketide	aspterric acid	Aspergillus terreus NIH2624
BGC0001928.1	0.16	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001647.1	0.12	Polyketide	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001289.1	0.12	RiPP	penisin	Paenibacillus ehimensis
BGC0001686.1	0.11	NRP	N-octanoyl-Met-Phe-H	Clostridium sp. CAG:567
BGC0001964.1	0.09	Polyketide	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001663.1	0.09	Polyketide	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110
BGC0000284.1	0.08	Polyketide	phenolic lipids	Azotobacter vinelandii DJ

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.1	0.69	Polyketide	alkylresorcinol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001831.1	0.52	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001475.1	0.48	Polyketide	aspterric acid	Aspergillus terreus NIH2624
BGC0001928.1	0.47	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001647.1	0.40	Polyketide	lagunapyrone A, lagunapyrone B, lagunapyrone C	Streptomyces sp. MP131-18
BGC0001289.1	0.39	RiPP	penisin	Paenibacillus ehimensis
BGC0001686.1	0.37	NRP	N-octanoyl-Met-Phe-H	Clostridium sp. CAG:567
BGC0001964.1	0.34	Polyketide	alkylpyrone-407, alkylpyrone-393	Cystobacterineae bacterium
BGC0001663.1	0.32	Polyketide	merocyclophane C, merocyclophane D	Nostoc sp. UIC 10110
BGC0000284.1	0.30	Polyketide	phenolic lipids	Azotobacter vinelandii DJ

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP014842.1 - Region 6 - terpene

Download region GenBank file

Download region SVG

Location: 2,094,581 - 2,116,470 nt. (total: 21,890 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001120.1	0.16	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0001925.1	0.15	Alkaloid	altemicidin, SB-203207, SB-203208	Streptomyces sp.
BGC0001535.1	0.14	Other	branched-chain fatty acids	Streptomyces filamentosus
BGC0002006.1	0.11	RiPP	albusnodin	Streptomyces albus
BGC0000313.1	0.11	NRP	beauvericin	Beauveria bassiana
BGC0001575.1	0.10	NRP	dipeptide aldehydes	Ruminococcus sp. 5_1_39BFAA
BGC0000663.1	0.09	Terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001739.1	0.09	Other	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001338.1	0.08	Polyketide	citrinin	Monascus ruber
BGC0000154.1	0.07	Polyketide	stipitatic acid	Talaromyces stipitatus ATCC 10500

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001120.1	0.47	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0001925.1	0.45	Alkaloid	altemicidin, SB-203207, SB-203208	Streptomyces sp.
BGC0001535.1	0.43	Other	branched-chain fatty acids	Streptomyces filamentosus
BGC0002006.1	0.39	RiPP	albusnodin	Streptomyces albus
BGC0000313.1	0.38	NRP	beauvericin	Beauveria bassiana
BGC0001575.1	0.36	NRP	dipeptide aldehydes	Ruminococcus sp. 5_1_39BFAA
BGC0000663.1	0.34	Terpene	hopene	Streptomyces coelicolor A3(2)
BGC0001739.1	0.32	Other	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001338.1	0.30	Polyketide	citrinin	Monascus ruber
BGC0000154.1	0.30	Polyketide	stipitatic acid	Talaromyces stipitatus ATCC 10500

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP014842.1 - Region 7 - betalactone

Download region GenBank file

Download region SVG

Location: 2,212,862 - 2,241,376 nt. (total: 28,515 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000234.1	0.21	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000259.1	0.20	Polyketide	prodigiosin	Serratia marcescens
BGC0000258.1	0.19	Polyketide	prodigiosin	Serratia sp.
BGC0000260.1	0.19	Polyketide	prodigiosin	Hahella chejuensis KCTC 2396
BGC0001897.1	0.18	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001103.1	0.18	NRP, Polyketide	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001983.1	0.16	Other	triacsins	Kitasatospora aureofaciens
BGC0001343.1	0.16	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000842.1	0.16	Other (Non-NRP beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000706.1	0.16	Saccharide	kanamycin	Streptomyces kanamyceticus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000234.1	0.54	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000259.1	0.53	Polyketide	prodigiosin	Serratia marcescens
BGC0000258.1	0.52	Polyketide	prodigiosin	Serratia sp.
BGC0000260.1	0.51	Polyketide	prodigiosin	Hahella chejuensis KCTC 2396
BGC0001897.1	0.50	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0001103.1	0.50	NRP, Polyketide	mycosubtilin	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001983.1	0.47	Other	triacsins	Kitasatospora aureofaciens
BGC0001343.1	0.47	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000842.1	0.46	Other (Non-NRP beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0000706.1	0.46	Saccharide	kanamycin	Streptomyces kanamyceticus

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP014842.1 - Region 8 - siderophore

Download region GenBank file

Download region SVG

Location: 3,032,453 - 3,047,919 nt. (total: 15,467 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.1	0.31	Other	petrobactin	Bacillus anthracis str. Ames
BGC0001499.1	0.29	Other	aerobactin	Pantoea ananatis
BGC0001478.1	0.27	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000852.1	0.25	Other	ectoine	Sporosarcina pasteurii
BGC0000941.1	0.25	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.1	0.25	Other	desferrioxamine E	Pantoea agglomerans
BGC0000858.1	0.25	Other	ectoine	Methylobacter marinus
BGC0000853.1	0.25	Other	ectoine	Streptomyces anulatus
BGC0000855.1	0.25	Other	ectoine	Methylomicrobium kenyense
BGC0000859.1	0.25	Other	ectoine	Methylomicrobium alcaliphilum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000942.1	0.64	Other	petrobactin	Bacillus anthracis str. Ames
BGC0001499.1	0.63	Other	aerobactin	Pantoea ananatis
BGC0001478.1	0.61	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000852.1	0.59	Other	ectoine	Sporosarcina pasteurii
BGC0000941.1	0.59	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.1	0.59	Other	desferrioxamine E	Pantoea agglomerans
BGC0000858.1	0.58	Other	ectoine	Methylobacter marinus
BGC0000853.1	0.58	Other	ectoine	Streptomyces anulatus
BGC0000855.1	0.58	Other	ectoine	Methylomicrobium kenyense
BGC0000859.1	0.58	Other	ectoine	Methylomicrobium alcaliphilum

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_CP014842.1 - Region 9 - RiPP-like,thiopeptide

Download region GenBank file

Download region SVG

Location: 3,169,947 - 3,211,238 nt. (total: 41,292 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)
RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Thiopeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000607.1	0.43	RiPP	micrococcin P1	Macrococcus caseolyticus
BGC0000571.1	0.32	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000554.1	0.32	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000617.1	0.32	RiPP	coagulin	Bacillus coagulans
BGC0001146.1	0.31	RiPP	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0001120.1	0.31	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0001928.1	0.30	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0000517.1	0.28	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000624.1	0.28	RiPP	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0001889.1	0.28	RiPP	fusilassin	Thermobifida fusca YX

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000607.1	0.59	RiPP	micrococcin P1	Macrococcus caseolyticus
BGC0000568.1	0.53	RiPP	microcin B17	Escherichia coli
BGC0000938.1	0.50	Other (Aminocoumarin)	fosfomycin	Streptomyces fradiae
BGC0000602.1	0.49	RiPP	subtilosin A	Bacillus subtilis subsp. spizizenii ATCC 6633
BGC0001120.1	0.48	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000599.1	0.48	RiPP	thuricin CD α, thuricin CD β	Bacillus thuringiensis
BGC0000483.1	0.48	RiPP	aeruginosamide B, aeruginosamide C	Microcystis aeruginosa PCC 9432
BGC0001146.1	0.48	RiPP	cyclothiazomycin C	Streptomyces sp. NRRL WC-3908
BGC0000554.1	0.48	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000523.1	0.47	RiPP	lactocin S	Lactobacillus sakei

Similar known gene clusters

Thiopeptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Thiopeptides

Core peptide predictions

No core peptides found.

NZ_CP014842.1 - Region 10 - NRPS

Download region GenBank file

Download region SVG

Location: 3,810,402 - 3,875,851 nt. (total: 65,450 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000381.1	1.00	NRP	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000389.1	0.43	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0000426.1	0.35	NRP	sevadicin	Paenibacillus larvae
BGC0001767.1	0.33	NRP	salinichelins	Salinispora pacifica CNY331
BGC0001833.1	0.33	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001615.1	0.33	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000417.1	0.33	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001128.1	0.32	NRP	luminmide	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001796.1	0.32	NRP	tauramamide	Brevibacillus laterosporus DSM 25
BGC0001844.1	0.32	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000381.1	1.00	NRP	lichenysin	Bacillus licheniformis DSM 13 = ATCC 14580
BGC0000389.1	0.74	NRP	massetolide A	Pseudomonas fluorescens SS101
BGC0000426.1	0.68	NRP	sevadicin	Paenibacillus larvae
BGC0001767.1	0.66	NRP	salinichelins	Salinispora pacifica CNY331
BGC0001833.1	0.66	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0001615.1	0.66	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0000417.1	0.66	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001128.1	0.66	NRP	luminmide	Photorhabdus laumondii subsp. laumondii TTO1
BGC0001796.1	0.65	NRP	tauramamide	Brevibacillus laterosporus DSM 25
BGC0001844.1	0.65	NRP	holrhizin	Paraburkholderia rhizoxinica HKI 454

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 10, location 3810401 - 3875851:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (gln - leu - D-leu) + (val - asp - D-leu) + (ile)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_3864

Search NORINE for peptide: strict or relaxed

AMP-binding (472..870): ile

NRPSPredictor2: ile

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: ile

Stachelhaus prediction details:

Stachelhaus sequence:: DGFFLGVVFK
Nearest Stachelhaus code:: ile
Stachelhaus code match:: 100% (strong)

ctg1_3865

Search NORINE for peptide: strict or relaxed

AMP-binding (470..862): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: val

Stachelhaus prediction details:

Stachelhaus sequence:: DAFWIGGTFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 100% (strong)

AMP-binding (1502..1905): asp

NRPSPredictor2: asp

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: asp, asn
Single AA prediction:: asp

Stachelhaus prediction details:

Stachelhaus sequence:: DLTKVGHIGK
Nearest Stachelhaus code:: asp
Stachelhaus code match:: 100% (strong)

AMP-binding (2547..2936): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

ctg1_3866

Search NORINE for peptide: strict or relaxed

AMP-binding (465..868): gln

NRPSPredictor2: gln

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: glu, gln
Single AA prediction:: gln

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLGVVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 100% (strong)

AMP-binding (1511..1909): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAFMLGMVFK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)

AMP-binding (2550..2939): leu

NRPSPredictor2: leu

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: leu

Stachelhaus prediction details:

Stachelhaus sequence:: DAWFLGNVVK
Nearest Stachelhaus code:: leu
Stachelhaus code match:: 100% (strong)