GCF_000942395.1_Pytheasella_massiliensis_genomic - 7 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LN812102.1

Region	Type	From	To
Region 5.1	terpene	954,948	974,048
Region 5.2	terpene	1,111,500	1,133,455
Region 5.3	RRE-containing	1,391,947	1,412,225
Region 5.4	siderophore	1,459,883	1,475,450
Region 5.5	T3PKS	1,526,714	1,567,769

NZ_LN812103.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	RRE-containing,lassopeptide	477,609	500,886
Region 6.2	terpene	940,323	961,303	anacyclamide A10	RiPP:Cyanobactin	14%

Region	Type	From	To	Most similar known cluster	Similarity
Region 5.1	terpene	954,948	974,048
Region 5.2	terpene	1,111,500	1,133,455
Region 5.3	RRE-containing	1,391,947	1,412,225
Region 5.4	siderophore	1,459,883	1,475,450
Region 5.5	T3PKS	1,526,714	1,567,769
Region 6.1	RRE-containing,lassopeptide	477,609	500,886
Region 6.2	terpene	940,323	961,303	anacyclamide A10	RiPP:Cyanobactin	14%

No secondary metabolite regions were found in these records:: NZ_LN812097.1; NZ_LN812099.1; NZ_LN812100.1; NZ_LN812101.1

Compact view

NZ_LN812102.1 - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 954,948 - 974,048 nt. (total: 19,101 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.1	0.20	Terpene	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001595.1	0.16	Alkaloid	fischerindole	Fischerella sp. SAG 46.79
BGC0000810.1	0.15	Alkaloid	benzoxazinone DIMBOA	Zea mays
BGC0001483.1	0.15	Other	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002009.1	0.14	Polyketide	kanglemycin A, kanglemycin V1, kanglemycin V2	Amycolatopsis vancoresmycina
BGC0001140.1	0.14	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0000763.1	0.13	Saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001947.1	0.13	Saccharide	K53 capsular polysaccharide	Acinetobacter baumannii
BGC0001914.1	0.13	Other	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001529.1	0.13	Alkaloid	bezastatin derivates	Streptomyces sp. RI18

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001310.1	0.53	Terpene	naringenin	Streptomyces clavuligerus ATCC 27064
BGC0001595.1	0.47	Alkaloid	fischerindole	Fischerella sp. SAG 46.79
BGC0000810.1	0.45	Alkaloid	benzoxazinone DIMBOA	Zea mays
BGC0001483.1	0.45	Other	5-isoprenylindole-3-carboxylate β-D-glycosyl ester	Streptomyces sp. RM-5-8
BGC0002009.1	0.43	Polyketide	kanglemycin A, kanglemycin V1, kanglemycin V2	Amycolatopsis vancoresmycina
BGC0001140.1	0.43	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0000763.1	0.42	Saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0001947.1	0.42	Saccharide	K53 capsular polysaccharide	Acinetobacter baumannii
BGC0001914.1	0.42	Other	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001529.1	0.42	Alkaloid	bezastatin derivates	Streptomyces sp. RI18

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LN812102.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 1,111,500 - 1,133,455 nt. (total: 21,956 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001458.1	0.15	Other (Aminocoumarin)	salinipostin G	Salinispora tropica CNB-440
BGC0000903.1	0.13	Other	fluorometabolite	Streptomyces cattleya
BGC0000663.1	0.13	Terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000670.1	0.13	Terpene	thalianol, thaliandiol	Arabidopsis thaliana
BGC0001791.1	0.11	NRP	sunshinamide	Gynuella sunshinyii YC6258
BGC0001000.1	0.10	NRP, Polyketide	hectochlorin	Lyngbya majuscula
BGC0000333.1	0.08	NRP	cyclomarin D	Salinispora arenicola CNS-205
BGC0001983.1	0.08	Other	triacsins	Kitasatospora aureofaciens
BGC0000969.1	0.08	NRP, Polyketide	chondramide A	Chondromyces crocatus
BGC0000433.1	0.07	NRP	surfactin	Bacillus velezensis FZB42

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001458.1	0.45	Other (Aminocoumarin)	salinipostin G	Salinispora tropica CNB-440
BGC0000903.1	0.42	Other	fluorometabolite	Streptomyces cattleya
BGC0000663.1	0.42	Terpene	hopene	Streptomyces coelicolor A3(2)
BGC0000670.1	0.41	Terpene	thalianol, thaliandiol	Arabidopsis thaliana
BGC0001791.1	0.37	NRP	sunshinamide	Gynuella sunshinyii YC6258
BGC0001000.1	0.35	NRP, Polyketide	hectochlorin	Lyngbya majuscula
BGC0000333.1	0.32	NRP	cyclomarin D	Salinispora arenicola CNS-205
BGC0001983.1	0.32	Other	triacsins	Kitasatospora aureofaciens
BGC0000969.1	0.30	NRP, Polyketide	chondramide A	Chondromyces crocatus
BGC0000433.1	0.29	NRP	surfactin	Bacillus velezensis FZB42

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LN812102.1 - Region 3 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1,391,947 - 1,412,225 nt. (total: 20,279 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001551.1	0.19	RiPP	citrulassin E	Streptomyces glaucescens
BGC0000504.1	0.15	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000554.1	0.15	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.15	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001120.1	0.14	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0001138.1	0.14	Other (Nucleoside)	a201a	Marinactinospora thermotolerans
BGC0000703.1	0.14	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000698.1	0.13	Saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000294.1	0.13	NRP	acinetobactin	Acinetobacter baumannii
BGC0002005.1	0.13	RiPP	RaxX	Xanthomonas oryzae pv. oryzae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001551.1	0.51	RiPP	citrulassin E	Streptomyces glaucescens
BGC0000504.1	0.46	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000554.1	0.45	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000500.1	0.45	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001120.1	0.43	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0001138.1	0.43	Other (Nucleoside)	a201a	Marinactinospora thermotolerans
BGC0000703.1	0.42	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000698.1	0.42	Saccharide	hygromycin A	Streptomyces hygroscopicus
BGC0000294.1	0.42	NRP	acinetobactin	Acinetobacter baumannii
BGC0002005.1	0.42	RiPP	RaxX	Xanthomonas oryzae pv. oryzae

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LN812102.1 - Region 4 - siderophore

Download region GenBank file

Download region SVG

Location: 1,459,883 - 1,475,450 nt. (total: 15,568 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.1	0.27	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.27	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.1	0.26	Other	desferrioxamine E	Pantoea agglomerans
BGC0000859.1	0.25	Other	ectoine	Methylomicrobium alcaliphilum
BGC0000854.1	0.25	Other	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0001531.1	0.25	Other	bisucaberin B	Tenacibaculum mesophilum
BGC0000857.1	0.25	Other	ectoine	Methylophaga alcalica
BGC0000855.1	0.25	Other	ectoine	Methylomicrobium kenyense
BGC0000853.1	0.25	Other	ectoine	Streptomyces anulatus
BGC0000858.1	0.25	Other	ectoine	Methylobacter marinus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001478.1	0.61	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.60	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001572.1	0.59	Other	desferrioxamine E	Pantoea agglomerans
BGC0000859.1	0.58	Other	ectoine	Methylomicrobium alcaliphilum
BGC0000854.1	0.58	Other	ectoine	Methylomicrobium alcaliphilum 20Z
BGC0001531.1	0.58	Other	bisucaberin B	Tenacibaculum mesophilum
BGC0000857.1	0.58	Other	ectoine	Methylophaga alcalica
BGC0000855.1	0.58	Other	ectoine	Methylomicrobium kenyense
BGC0000853.1	0.58	Other	ectoine	Streptomyces anulatus
BGC0000858.1	0.58	Other	ectoine	Methylobacter marinus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LN812102.1 - Region 5 - T3PKS

Download region GenBank file

Download region SVG

Location: 1,526,714 - 1,567,769 nt. (total: 41,056 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.1	0.34	Polyketide	alkylresorcinol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001938.1	0.32	Polyketide	entotheonella	Candidatus Entotheonella serta
BGC0001962.1	0.32	Polyketide	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001831.1	0.22	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001927.1	0.17	Other	A-94964	Streptomyces sp.
BGC0001779.1	0.16	RiPP	siamycin	Streptomyces nodosus
BGC0000521.1	0.16	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.1	0.16	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000563.1	0.16	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000626.1	0.16	RiPP	thuricin	Bacillus thuringiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000282.1	0.67	Polyketide	alkylresorcinol	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001938.1	0.66	Polyketide	entotheonella	Candidatus Entotheonella serta
BGC0001962.1	0.65	Polyketide	hierridin B, hierridin C	Cyanobium sp. LEGE 06113
BGC0001831.1	0.55	Polyketide	alkylpyrone-407, alkylpyrone-393	Myxococcus xanthus DK 1622
BGC0001927.1	0.48	Other	A-94964	Streptomyces sp.
BGC0001779.1	0.47	RiPP	siamycin	Streptomyces nodosus
BGC0000521.1	0.47	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000539.1	0.47	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000563.1	0.47	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000626.1	0.47	RiPP	thuricin	Bacillus thuringiensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LN812103.1 - Region 1 - RRE-containing,lassopeptide

Download region GenBank file

Download region SVG

Location: 477,609 - 500,886 nt. (total: 23,278 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])
lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lasso peptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000575.1	0.61	RiPP	lariatin	Rhodococcus jostii
BGC0000540.1	0.37	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000543.1	0.33	RiPP	pep5	Staphylococcus epidermidis
BGC0000552.1	0.33	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001173.1	0.32	RiPP	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001210.1	0.32	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000517.1	0.32	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001229.1	0.32	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000518.1	0.32	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000513.1	0.32	RiPP	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000575.1	0.64	RiPP	lariatin	Rhodococcus jostii
BGC0000540.1	0.50	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000543.1	0.50	RiPP	pep5	Staphylococcus epidermidis
BGC0000497.1	0.48	RiPP	BHT-Aα, BHT-Aβ	Streptococcus ratti
BGC0000552.1	0.47	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001173.1	0.47	RiPP	plantazolicin	Bacillus pumilus ATCC 7061
BGC0001210.1	0.47	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000517.1	0.47	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0001229.1	0.47	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000518.1	0.47	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736

Similar known gene clusters

No matches found.

Lasso peptide predictions

Lassopeptide(s) for ctg6_505 - Putative Class II

ctg6_505 leader / core peptide / cleaved tail: MLELTLKGSHTEVIQLMRWIECLSTINSVTFQGDSSVKCHVKLNQLHKMPNSTVEMKTESGADIQIQLSDCEMVTL - GKKTVLRGKHYDIF

Lassopeptide(s) for ctg6_507 - Putative Class II

ctg6_507 leader / core peptide / cleaved tail: MENQKQEKKEYTSPNLIVLGNIVEITF - GGAGGHDTDTYSTKYPRSE

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lasso peptides

Core peptide predictions

ctg6_505 - Class II: Cleavage pHMM score: -6.40; RODEO score: 16; Monoisotopic mass: 1642.9 Da; Molecular weight: 1643.9 Da; Number of bridges: 0
ctg6_507 - Class II: Cleavage pHMM score: -1.00; RODEO score: 27; Monoisotopic mass: 1979.9 Da; Molecular weight: 1981.0 Da; Number of bridges: 0

NZ_LN812103.1 - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 940,323 - 961,303 nt. (total: 20,981 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	terpene	Similarity score	Type	Compound(s)	Organism
BGC0000472.1		0.08	RiPP	anacyclamide A10	Anabaena sp. 90
BGC0000565.1		0.07	RiPP	goadsporin	Streptomyces sp. TP-A0584

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000472.1		0.30	RiPP	anacyclamide A10	Anabaena sp. 90
BGC0000565.1		0.29	RiPP	goadsporin	Streptomyces sp. TP-A0584

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names