GCF_900475035.1_41965_F01_genomic - 4 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LS483338.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	T3PKS	1,050,125	1,091,300
Region 2	LAP	1,188,075	1,211,841	streptolysin S	RiPP:LAP	100%
Region 3	lanthipeptide-class-ii	1,289,900	1,312,683	streptococcin A-FF22	RiPP:Lanthipeptide	100%
Region 4	RiPP-like	1,360,394	1,372,258

NZ_LS483338.1 - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 1,050,125 - 1,091,300 nt. (total: 41,176 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.1	0.18	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0001521.1	0.17	NRP	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001591.1	0.16	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.16	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0000626.1	0.15	RiPP	thuricin	Bacillus thuringiensis
BGC0000668.1	0.15	Terpene, Alkaloid	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001863.1	0.15	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0000490.1	0.15	RiPP	garvicin ML	Lactococcus garvieae DCC43
BGC0001222.1	0.15	RiPP	acidocin B	Lactobacillus acidophilus
BGC0000491.1	0.15	RiPP	gassericin A	Lactobacillus gasseri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.1	0.49	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0001521.1	0.49	NRP	auriculamide	Herpetosiphon aurantiacus DSM 785
BGC0001591.1	0.46	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.46	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0000626.1	0.46	RiPP	thuricin	Bacillus thuringiensis
BGC0000668.1	0.46	Terpene, Alkaloid	12-epi-hapalindole C isonitrile, 12-epi-hapalindole E, 12-epi-fischerindole U isonitrile, fischerindole L, 12-epi-fischerindole I isonitrile, welwitindolinone A isonitrile, welwitindolinone B isothiocyanate, welwitindolinone C isothiocyanate, N-methylwelwitindolinone C isothiocyanate, N-methylwelwitinsolinone C isonitrile, 3-epi-welwitindolinone B isothiocyanate, 3-(Z-2'-isocyanoethenyl)-indole	Hapalosiphon welwitschii UTEX B 1830
BGC0001863.1	0.45	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0000490.1	0.45	RiPP	garvicin ML	Lactococcus garvieae DCC43
BGC0001222.1	0.45	RiPP	acidocin B	Lactobacillus acidophilus
BGC0000491.1	0.45	RiPP	gassericin A	Lactobacillus gasseri

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LS483338.1 - Region 2 - LAP

Download region GenBank file

Download region SVG

Location: 1,188,075 - 1,211,841 nt. (total: 23,767 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000566.1	1.00	RiPP	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0001170.1	0.36	RiPP	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.1	0.36	RiPP	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0000569.1	0.31	RiPP	plantazolicin	Bacillus velezensis FZB42
BGC0001173.1	0.31	RiPP	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000568.1	0.27	RiPP	microcin B17	Escherichia coli
BGC0001171.1	0.21	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000565.1	0.17	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000643.1	0.17	Terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.1	0.16	Terpene	carotenoid	Brevundimonas sp. SD212

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000566.1	1.00	RiPP	streptolysin S	Streptococcus pyogenes M1 GAS
BGC0001170.1	0.68	RiPP	clostridiolysin S	Clostridium sporogenes ATCC 15579
BGC0000564.1	0.68	RiPP	clostridiolysin S	Clostridium botulinum A str. ATCC 3502
BGC0000569.1	0.64	RiPP	plantazolicin	Bacillus velezensis FZB42
BGC0001173.1	0.64	RiPP	plantazolicin	Bacillus pumilus ATCC 7061
BGC0000568.1	0.60	RiPP	microcin B17	Escherichia coli
BGC0001171.1	0.53	RiPP	listeriolysin S	Listeria monocytogenes serotype 4b str. F2365
BGC0000565.1	0.48	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0000643.1	0.48	Terpene	carotenoid	Brevundimonas vesicularis
BGC0000634.1	0.47	Terpene	carotenoid	Brevundimonas sp. SD212

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LS483338.1 - Region 3 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 1,289,900 - 1,312,683 nt. (total: 22,784 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000557.1	0.86	RiPP	streptococcin A-FF22	Streptococcus pyogenes
BGC0001788.1	0.58	RiPP	suicin 65	Streptococcus suis
BGC0000550.1	0.50	RiPP	salivaricin G32	Streptococcus salivarius
BGC0000526.1	0.44	RiPP	macedocin	Streptococcus macedonicus
BGC0000626.1	0.36	RiPP	thuricin	Bacillus thuringiensis
BGC0000528.1	0.36	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001787.1	0.36	RiPP	suicin 3908	Streptococcus suis
BGC0000547.1	0.35	RiPP	salivaricin 9	Streptococcus salivarius
BGC0000534.1	0.34	RiPP	mutacin K8	Streptococcus mutans
BGC0001579.1	0.33	RiPP	duramycin	Streptomyces cinnamoneus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000557.1	0.95	RiPP	streptococcin A-FF22	Streptococcus pyogenes
BGC0001788.1	0.83	RiPP	suicin 65	Streptococcus suis
BGC0000550.1	0.79	RiPP	salivaricin G32	Streptococcus salivarius
BGC0000526.1	0.75	RiPP	macedocin	Streptococcus macedonicus
BGC0000626.1	0.69	RiPP	thuricin	Bacillus thuringiensis
BGC0000528.1	0.69	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001787.1	0.69	RiPP	suicin 3908	Streptococcus suis
BGC0000547.1	0.68	RiPP	salivaricin 9	Streptococcus salivarius
BGC0000534.1	0.67	RiPP	mutacin K8	Streptococcus mutans
BGC0001579.1	0.66	RiPP	duramycin	Streptomyces cinnamoneus

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_1230 - Putative Class II

ctg1_1231 leader / core peptide: MEEKMCLGALNALQEFQIEELDNLLGG - RGHGVNDhbIDhaAECRWNDhaLQAIFDhbCC
ctg1_1232 leader / core peptide: MTKEHEIINSIQEVSLEELDQIIGA - GKNGVFKDhbIDhaHECHLNDhbWAFLADhbCCDha
ctg1_1233 leader / core peptide: MEKNNEVINSIQEVSLEELDQIIGA - GKNGVFKDhbIDhaHECHLNDhbWAFLADhbCCDha
ctg1_1246 leader / core peptide: MQLPNKLYSYQKSTLAYLPRVLNEIKSGNSNVKDIFHA - IDhaEELDDPDhbDFLDhaIMDCLYALNAIEMDhaNEGEVKLCL
allorf_1307948_1308163 leader / core peptide: VKIYKNCLELANKLSG - YHCDhaVFEFPYKKIKKFFKHELYDhaRHHYIIVRLDGDhaMEYRFDhaDhaVALKNKIKDhaILDDha

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_1231 - Class II

Cleavage pHMM score: 3.80

RODEO score: 0

Monoisotopic mass: 2593.2 Da

Molecular weight: 2594.9 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2613.0 Da N = 1

ctg1_1232 - Class II

Cleavage pHMM score: 5.20

RODEO score: 0

Monoisotopic mass: 2776.3 Da

Molecular weight: 2778.2 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2796.2 Da N = 1; 2814.2 Da N = 2

ctg1_1233 - Class II

Cleavage pHMM score: 5.20

RODEO score: 0

Monoisotopic mass: 2776.3 Da

Molecular weight: 2778.2 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2796.2 Da N = 1; 2814.2 Da N = 2

ctg1_1246 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 3960.9 Da

Molecular weight: 3963.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3981.5 Da N = 1; 3999.5 Da N = 2

allorf_1307948_1308163 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 6598.5 Da

Molecular weight: 6602.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6620.7 Da N = 1; 6638.7 Da N = 2; 6656.7 Da N = 3; 6674.7 Da N = 4; 6692.8 Da N = 5; 6710.8 Da N = 6

NZ_LS483338.1 - Region 4 - RiPP-like

Download region GenBank file

Download region SVG

Location: 1,360,394 - 1,372,258 nt. (total: 11,865 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	RiPP-like	Similarity score	Type	Compound(s)	Organism
BGC0000526.1		0.04	RiPP	macedocin	Streptococcus macedonicus

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000526.1		0.20	RiPP	macedocin	Streptococcus macedonicus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names