GCF_022845755.1_ASM2284575v1_genomic - 3 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_AP025566.1

Region	Type	From	To
Region 1	lanthipeptide-class-ii	167,929	191,054
Region 2	RRE-containing	1,440,795	1,461,164
Region 3	ranthipeptide	2,390,634	2,412,264

NZ_AP025566.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 167,929 - 191,054 nt. (total: 23,126 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	0.25	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001361.1	0.24	Terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001364.1	0.20	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001407.1	0.18	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000554.1	0.18	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000703.1	0.17	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001210.1	0.15	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001412.1	0.15	Saccharide	polysaccharide C	Bacteroides fragilis
BGC0001664.1	0.15	Terpene	merosterol	Scytonema sp. PCC 10023
BGC0000792.1	0.15	Saccharide	polysaccharide	Enterococcus faecalis OG1RF

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000525.1	0.59	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0001361.1	0.57	Terpene	sodorifen	Serratia plymuthica 4Rx13
BGC0001364.1	0.52	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001407.1	0.50	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000554.1	0.49	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000703.1	0.48	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0001210.1	0.46	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001412.1	0.46	Saccharide	polysaccharide C	Bacteroides fragilis
BGC0001664.1	0.46	Terpene	merosterol	Scytonema sp. PCC 10023
BGC0000792.1	0.45	Saccharide	polysaccharide	Enterococcus faecalis OG1RF

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_156 - Putative Class II

ctg1_155 leader / core peptide: MQREEKNVAITGDLNLEFEEMQKLVDEEVGVPYS - DhbWDhaKACDhbDhaFCDhbIICC
allorf_0182617_0182724 leader / core peptide: MLYYSTLYAIRDTLNLA - GDGGNLNFPRPQPNDhaGCP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_155 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 1575.7 Da

Molecular weight: 1576.9 Da

Number of bridges: 4

Alternative weights: (assuming N unmodified Ser/Thr residues); 1594.9 Da N = 1

allorf_0182617_0182724 - Class II

Cleavage pHMM score: -5.00

RODEO score: 0

Monoisotopic mass: 1807.8 Da

Molecular weight: 1808.9 Da

Number of bridges: 1

NZ_AP025566.1 - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1,440,795 - 1,461,164 nt. (total: 20,370 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.1	0.18	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000554.1	0.16	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001576.1	0.16	RiPP	divamide A	Prochloron didemni
BGC0000519.1	0.16	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000500.1	0.15	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000504.1	0.15	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000501.1	0.15	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001210.1	0.15	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000521.1	0.15	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000491.1	0.15	RiPP	gassericin A	Lactobacillus gasseri

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000551.1	0.49	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000554.1	0.46	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001576.1	0.46	RiPP	divamide A	Prochloron didemni
BGC0000519.1	0.46	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000500.1	0.46	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000504.1	0.46	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000501.1	0.46	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0001210.1	0.46	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0000521.1	0.45	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000491.1	0.45	RiPP	gassericin A	Lactobacillus gasseri

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_AP025566.1 - Region 3 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 2,390,634 - 2,412,264 nt. (total: 21,631 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.1	0.17	Other	nucleocidin	Streptomyces calvus
BGC0000466.1	0.15	NRP	yatakemycin	Streptomyces sp. TP-A2060
BGC0001540.1	0.14	Other	CC-1065	Streptomyces zelensis
BGC0001607.1	0.14	Other	gilvusmycin	Streptomyces sp. NRRL B-1347
BGC0000842.1	0.12	Other (Non-NRP beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001860.1	0.10	RiPP	thiomuracin	Thermobispora bispora DSM 43833
BGC0001591.1	0.09	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.09	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001155.1	0.08	RiPP	GE2270	Planobispora rosea
BGC0000604.1	0.08	RiPP	GE2270A	Nonomuraea sp. WU8817

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001387.1	0.48	Other	nucleocidin	Streptomyces calvus
BGC0000466.1	0.45	NRP	yatakemycin	Streptomyces sp. TP-A2060
BGC0001540.1	0.43	Other	CC-1065	Streptomyces zelensis
BGC0001607.1	0.43	Other	gilvusmycin	Streptomyces sp. NRRL B-1347
BGC0000842.1	0.41	Other (Non-NRP beta-lactam)	carbapenem MM4550	Streptomyces argenteolus
BGC0001860.1	0.36	RiPP	thiomuracin	Thermobispora bispora DSM 43833
BGC0001591.1	0.32	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.32	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001155.1	0.32	RiPP	GE2270	Planobispora rosea
BGC0000604.1	0.31	RiPP	GE2270A	Nonomuraea sp. WU8817

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names