GCF_001405615.1_13414_6_47_genomic - 6 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_CYXV01000002 (original name was: NZ_CYXV01000002.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	cyclic-lactone-autoinducer	349,231	365,375

NZ_CYXV01000003 (original name was: NZ_CYXV01000003.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	ranthipeptide,lanthipeptide-class-ii	34,912	79,026	ruminococcin A	RiPP:Lanthipeptide	21%
Region 3.2	cyclic-lactone-autoinducer	123,230	143,016
Region 3.3	cyclic-lactone-autoinducer	188,355	209,081

NZ_CYXV01000007 (original name was: NZ_CYXV01000007.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 7.1	cyclic-lactone-autoinducer	143,561	163,740

NZ_CYXV01000008 (original name was: NZ_CYXV01000008.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	cyclic-lactone-autoinducer,ranthipeptide	1	22,637

Region	Type	From	To	Most similar known cluster	Similarity
Region 2.1	cyclic-lactone-autoinducer	349,231	365,375
Region 3.1	ranthipeptide,lanthipeptide-class-ii	34,912	79,026	ruminococcin A	RiPP:Lanthipeptide	21%
Region 3.2	cyclic-lactone-autoinducer	123,230	143,016
Region 3.3	cyclic-lactone-autoinducer	188,355	209,081
Region 7.1	cyclic-lactone-autoinducer	143,561	163,740
Region 8.1	cyclic-lactone-autoinducer,ranthipeptide	1	22,637

No secondary metabolite regions were found in these records:: NZ_CYXV01000001 (original name was: NZ_CYXV01000001.1); NZ_CYXV01000004 (original name was: NZ_CYXV01000004.1); NZ_CYXV01000005 (original name was: NZ_CYXV01000005.1); NZ_CYXV01000006 (original name was: NZ_CYXV01000006.1); NZ_CYXV01000009 (original name was: NZ_CYXV01000009.1); NZ_CYXV01000010 (original name was: NZ_CYXV01000010.1); NZ_CYXV01000011 (original name was: NZ_CYXV01000011.1); NZ_CYXV01000012 (original name was: NZ_CYXV01000012.1); NZ_CYXV01000013 (original name was: NZ_CYXV01000013.1); NZ_CYXV01000014 (original name was: NZ_CYXV01000014.1); NZ_CYXV01000015 (original name was: NZ_CYXV01000015.1); NZ_CYXV01000016 (original name was: NZ_CYXV01000016.1); NZ_CYXV01000017 (original name was: NZ_CYXV01000017.1); NZ_CYXV01000018 (original name was: NZ_CYXV01000018.1); NZ_CYXV01000019 (original name was: NZ_CYXV01000019.1); NZ_CYXV01000020 (original name was: NZ_CYXV01000020.1); NZ_CYXV01000021 (original name was: NZ_CYXV01000021.1); NZ_CYXV01000022 (original name was: NZ_CYXV01000022.1); NZ_CYXV01000023 (original name was: NZ_CYXV01000023.1); NZ_CYXV01000024 (original name was: NZ_CYXV01000024.1); NZ_CYXV01000025 (original name was: NZ_CYXV01000025.1); NZ_CYXV01000026 (original name was: NZ_CYXV01000026.1); NZ_CYXV01000027 (original name was: NZ_CYXV01000027.1); NZ_CYXV01000028 (original name was: NZ_CYXV01000028.1); NZ_CYXV01000029 (original name was: NZ_CYXV01000029.1); NZ_CYXV01000030 (original name was: NZ_CYXV01000030.1); NZ_CYXV01000031 (original name was: NZ_CYXV01000031.1); NZ_CYXV01000032 (original name was: NZ_CYXV01000032.1); NZ_CYXV01000033 (original name was: NZ_CYXV01000033.1); NZ_CYXV01000034 (original name was: NZ_CYXV01000034.1); NZ_CYXV01000035 (original name was: NZ_CYXV01000035.1); NZ_CYXV01000036 (original name was: NZ_CYXV01000036.1)

Compact view

c00002_NZ_CYXV.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 349,231 - 365,375 nt. (total: 16,145 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	cyclic-lactone-autoinducer	Similarity score	Type	Compound(s)	Organism
BGC0000758.1		0.14	Saccharide	capsular polysaccharide	Staphylococcus aureus
BGC0000486.1		0.09	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens

Reference	Aggregated	Similarity score	Type	Compound(s)	Organism
BGC0000758.1		0.43	Saccharide	capsular polysaccharide	Staphylococcus aureus
BGC0000486.1		0.33	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00003_NZ_CYXV.. - Region 1 - lanthipeptide-class-ii,ranthipeptide

Download region GenBank file

Download region SVG

Location: 34,912 - 79,026 nt. (total: 44,115 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.35	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000528.1	0.35	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.1	0.29	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000243.1	0.29	Polyketide	macrotetrolide	Streptomyces griseus subsp. griseus
BGC0001787.1	0.27	RiPP	suicin 3908	Streptococcus suis
BGC0000558.1	0.25	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001660.1	0.23	RiPP	mathermycin	Marinactinospora thermotolerans
BGC0000551.1	0.21	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000519.1	0.20	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000504.1	0.18	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.68	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000528.1	0.68	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000516.1	0.66	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0001787.1	0.63	RiPP	suicin 3908	Streptococcus suis
BGC0001660.1	0.60	RiPP	mathermycin	Marinactinospora thermotolerans
BGC0000525.1	0.59	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000558.1	0.58	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0001229.1	0.57	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000504.1	0.56	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000551.1	0.54	RiPP	SapB	Streptomyces coelicolor A3(2)

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg3_69 - Putative Class II

ctg3_58 leader / core peptide: MEIKSILIKDTTREERIRIVQEGLNQCGGA - CDFCNGCDNLGGGDhaVDAFYEPYINGEKELREINEEYRDhaNDhaGLVK
ctg3_66 leader / core peptide: MKDLRNPLTRTENFEHPSGNIMKELTEAELNSVAAG - AGVARNDhaGGIACDhbLDhbGECNIGDhbHIKFCCYD

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg3_58 - Class II: Cleavage pHMM score: -5.40; RODEO score: 0; Monoisotopic mass: 4849.2 Da; Molecular weight: 4852.2 Da; Number of bridges: 3
ctg3_66 - Class II: Cleavage pHMM score: 1.20; RODEO score: 0; Monoisotopic mass: 3001.4 Da; Molecular weight: 3003.4 Da; Number of bridges: 4

c00003_NZ_CYXV.. - Region 2 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 123,230 - 143,016 nt. (total: 19,787 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.17	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000783.1	0.16	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000526.1	0.05	RiPP	macedocin	Streptococcus macedonicus
BGC0000103.1	0.04	Polyketide	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000158.1	0.03	Polyketide	tautomycetin	Streptomyces griseochromogenes

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.49	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000783.1	0.46	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0000526.1	0.23	RiPP	macedocin	Streptococcus macedonicus
BGC0000103.1	0.20	Polyketide	mycolactone B	Mycobacterium ulcerans Agy99
BGC0000158.1	0.17	Polyketide	tautomycetin	Streptomyces griseochromogenes

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00003_NZ_CYXV.. - Region 3 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 188,355 - 209,081 nt. (total: 20,727 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.19	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.19	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000560.1	0.18	RiPP	subtilomycin	Bacillus subtilis
BGC0000543.1	0.18	RiPP	pep5	Staphylococcus epidermidis
BGC0000488.1	0.17	RiPP	circularin A	Clostridium beijerinckii
BGC0000540.1	0.17	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000572.1	0.16	RiPP	capistruin	Burkholderia thailandensis E444
BGC0001407.1	0.16	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000517.1	0.15	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000802.1	0.15	Saccharide	succinoglycan	Sinorhizobium meliloti

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.51	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.51	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000560.1	0.50	RiPP	subtilomycin	Bacillus subtilis
BGC0000543.1	0.50	RiPP	pep5	Staphylococcus epidermidis
BGC0000488.1	0.49	RiPP	circularin A	Clostridium beijerinckii
BGC0000540.1	0.48	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000572.1	0.46	RiPP	capistruin	Burkholderia thailandensis E444
BGC0001407.1	0.46	RiPP	bicereucin	Bacillus cereus SJ1
BGC0000517.1	0.46	RiPP	haloduracin β, haloduracin α	Bacillus halodurans C-125
BGC0000802.1	0.46	Saccharide	succinoglycan	Sinorhizobium meliloti

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00007_NZ_CYXV.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 143,561 - 163,740 nt. (total: 20,180 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001774.1	0.14	Other	spicamycin	Streptomyces fimbriatus
BGC0000691.1	0.10	Saccharide	acarbose	Actinoplanes sp. SE50/110
BGC0000495.1	0.07	RiPP	actagardine	Actinoplanes garbadinensis
BGC0001055.1	0.06	NRP, Polyketide	yersiniabactin	Escherichia coli
BGC0001598.1	0.05	NRP, Polyketide	foxicins A-D	Streptomyces diastatochromogenes
BGC0000268.1	0.04	Polyketide	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0000144.1	0.04	Polyketide	salinomycin	Streptomyces albus
BGC0000163.1	0.03	Polyketide	tetronasin	Streptomyces longisporoflavus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001774.1	0.43	Other	spicamycin	Streptomyces fimbriatus
BGC0000691.1	0.36	Saccharide	acarbose	Actinoplanes sp. SE50/110
BGC0000495.1	0.29	RiPP	actagardine	Actinoplanes garbadinensis
BGC0001055.1	0.24	NRP, Polyketide	yersiniabactin	Escherichia coli
BGC0001598.1	0.22	NRP, Polyketide	foxicins A-D	Streptomyces diastatochromogenes
BGC0000268.1	0.20	Polyketide	Sch-47554, Sch-47555	Streptomyces sp. SCC 2136
BGC0000144.1	0.17	Polyketide	salinomycin	Streptomyces albus
BGC0000163.1	0.17	Polyketide	tetronasin	Streptomyces longisporoflavus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00008_NZ_CYXV.. - Region 1 - cyclic-lactone-autoinducer,ranthipeptide

Download region GenBank file

Download region SVG

Location: 1 - 22,637 nt. (total: 22,637 nt) Show pHMM detection rules used

Region on contig edge.

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)
ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000601.1	0.44	RiPP	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000488.1	0.42	RiPP	circularin A	Clostridium beijerinckii
BGC0000540.1	0.40	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000599.1	0.37	RiPP	thuricin CD α, thuricin CD β	Bacillus thuringiensis
BGC0000504.1	0.37	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000600.1	0.36	RiPP	thurincin H	Bacillus thuringiensis
BGC0000560.1	0.36	RiPP	subtilomycin	Bacillus subtilis
BGC0000543.1	0.35	RiPP	pep5	Staphylococcus epidermidis
BGC0000565.1	0.32	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0001551.1	0.31	RiPP	citrulassin E	Streptomyces glaucescens

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000601.1	0.55	RiPP	sporulation killing factor	Bacillus subtilis subsp. subtilis str. 168
BGC0000488.1	0.53	RiPP	circularin A	Clostridium beijerinckii
BGC0000540.1	0.52	RiPP	paenibacillin	Paenibacillus polymyxa OSY-DF
BGC0000599.1	0.51	RiPP	thuricin CD α, thuricin CD β	Bacillus thuringiensis
BGC0000504.1	0.51	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000600.1	0.50	RiPP	thurincin H	Bacillus thuringiensis
BGC0000560.1	0.49	RiPP	subtilomycin	Bacillus subtilis
BGC0000543.1	0.49	RiPP	pep5	Staphylococcus epidermidis
BGC0000565.1	0.47	RiPP	goadsporin	Streptomyces sp. TP-A0584
BGC0001551.1	0.46	RiPP	citrulassin E	Streptomyces glaucescens

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names