GCF_000196615.1_ASM19661v1_genomic - 8 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NC_014306.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	betalactone	420,248	448,558
Region 1.2	NRPS	729,230	773,171
Region 1.3	hserlactone	1,273,703	1,293,835
Region 1.4	thiopeptide	1,678,538	1,704,765	O-antigen	Saccharide	14%
Region 1.5	hserlactone,arylpolyene	1,768,025	1,826,428	aryl polyenes	Other	88%
Region 1.6	lanthipeptide-class-ii	2,516,085	2,538,868
Region 1.7	siderophore	2,810,984	2,823,335	desferrioxamine E	Other	100%
Region 1.8	RRE-containing	4,185,510	4,205,794	lankacidin C	NRP + Polyketide	13%

Region	Type	From	To	Most similar known cluster	Similarity
Region 1.1	betalactone	420,248	448,558
Region 1.2	NRPS	729,230	773,171
Region 1.3	hserlactone	1,273,703	1,293,835
Region 1.4	thiopeptide	1,678,538	1,704,765	O-antigen	Saccharide	14%
Region 1.5	hserlactone,arylpolyene	1,768,025	1,826,428	aryl polyenes	Other	88%
Region 1.6	lanthipeptide-class-ii	2,516,085	2,538,868
Region 1.7	siderophore	2,810,984	2,823,335	desferrioxamine E	Other	100%
Region 1.8	RRE-containing	4,185,510	4,205,794	lankacidin C	NRP + Polyketide	13%

No secondary metabolite regions were found in these records:: NC_014304.1; NC_014305.1

Compact view

NC_014306.1 - Region 1 - betalactone

Download region GenBank file

Download region SVG

Location: 420,248 - 448,558 nt. (total: 28,311 nt) Show pHMM detection rules used

betalactone: (HMGL-like and AMP-binding)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.1	0.19	Other	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.1	0.15	Other	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000506.1	0.14	RiPP	entianin	Bacillus subtilis subsp. spizizenii
BGC0000342.1	0.14	NRP	enniatin	Fusarium equiseti
BGC0000597.1	0.13	RiPP	SWA-2138	Streptomyces sp. e14
BGC0000595.1	0.13	RiPP	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000596.1	0.13	RiPP	SLI-2138	Streptomyces lividans TK24
BGC0000896.1	0.13	Other	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000922.1	0.13	Other	pseudomonas quinolone signal (PQS)	Pseudomonas aeruginosa PAO1
BGC0000805.1	0.13	Saccharide	moenomycin	Streptomyces viridosporus ATCC 14672

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001441.1	0.50	Other	belactosin A, belactosin C	Streptomyces sp.
BGC0001440.1	0.46	Other	cystargolide A, cystargolide B	Kitasatospora cystarginea
BGC0000506.1	0.43	RiPP	entianin	Bacillus subtilis subsp. spizizenii
BGC0000342.1	0.43	NRP	enniatin	Fusarium equiseti
BGC0000597.1	0.42	RiPP	SWA-2138	Streptomyces sp. e14
BGC0000595.1	0.42	RiPP	SCO-2138	Streptomyces coelicolor A3(2)
BGC0000596.1	0.42	RiPP	SLI-2138	Streptomyces lividans TK24
BGC0000896.1	0.42	Other	cycloserine	Streptomyces lavendulae subsp. lavendulae
BGC0000922.1	0.41	Other	pseudomonas quinolone signal (PQS)	Pseudomonas aeruginosa PAO1
BGC0000805.1	0.41	Saccharide	moenomycin	Streptomyces viridosporus ATCC 14672

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NC_014306.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 729,230 - 773,171 nt. (total: 43,942 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000457.1	0.33	NRP	vicibactin	Rhizobium etli CFN 42
BGC0001149.1	0.27	NRP, Saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001873.1	0.26	NRP	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0000325.1	0.26	NRP	coelichelin	Streptomyces coelicolor A3(2)
BGC0001585.1	0.25	Alkaloid	melinacidin IV	Escovopsis weberi
BGC0000342.1	0.25	NRP	enniatin	Fusarium equiseti
BGC0000313.1	0.25	NRP	beauvericin	Beauveria bassiana
BGC0001833.1	0.25	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000292.1	0.25	NRP	acetylaranotin	Aspergillus terreus NIH2624
BGC0001132.1	0.25	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000457.1	0.66	NRP	vicibactin	Rhizobium etli CFN 42
BGC0001149.1	0.61	NRP, Saccharide	brabantamide A	Pseudomonas sp. SHC52
BGC0001873.1	0.60	NRP	pyrrolizixenamide A	Xenorhabdus szentirmaii DSM 16338
BGC0000325.1	0.60	NRP	coelichelin	Streptomyces coelicolor A3(2)
BGC0001585.1	0.59	Alkaloid	melinacidin IV	Escovopsis weberi
BGC0000342.1	0.59	NRP	enniatin	Fusarium equiseti
BGC0000313.1	0.59	NRP	beauvericin	Beauveria bassiana
BGC0001833.1	0.59	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000292.1	0.58	NRP	acetylaranotin	Aspergillus terreus NIH2624
BGC0001132.1	0.58	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061

Similar known gene clusters

No matches found.

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 729229 - 773171:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_656

Search NORINE for peptide: strict or relaxed

AMP-binding (465..867): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

NC_014306.1 - Region 3 - hserlactone

Download region GenBank file

Download region SVG

Location: 1,273,703 - 1,293,835 nt. (total: 20,133 nt) Show pHMM detection rules used

hserlactone: Autoind_synth

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.16	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000703.1	0.16	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000500.1	0.16	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001862.1	0.16	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.16	RiPP	pallidocin	Aeribacillus pallidus
BGC0001861.1	0.16	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000504.1	0.15	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001859.1	0.15	Other (Phosphonate)	fosfomycin	Pseudomonas syringae
BGC0000294.1	0.15	NRP	acinetobactin	Acinetobacter baumannii
BGC0001120.1	0.15	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.47	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000703.1	0.47	Saccharide	kanamycin	Streptomyces kanamyceticus
BGC0000500.1	0.47	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001862.1	0.46	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.46	RiPP	pallidocin	Aeribacillus pallidus
BGC0001861.1	0.46	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000504.1	0.46	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001859.1	0.46	Other (Phosphonate)	fosfomycin	Pseudomonas syringae
BGC0000294.1	0.45	NRP	acinetobactin	Acinetobacter baumannii
BGC0001120.1	0.45	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NC_014306.1 - Region 4 - thiopeptide

Download region GenBank file

Download region SVG

Location: 1,678,538 - 1,704,765 nt. (total: 26,228 nt) Show pHMM detection rules used

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Thiopeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000784.1	0.24	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000496.1	0.16	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.16	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000781.1	0.16	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000519.1	0.16	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001928.1	0.16	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001494.1	0.16	RiPP	acinetodin	Acinetobacter gyllenbergii CIP 110306
BGC0000571.1	0.16	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001639.1	0.15	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000501.1	0.15	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000784.1	0.58	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000496.1	0.47	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.47	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000781.1	0.47	Saccharide	O-antigen	Pseudomonas aeruginosa
BGC0000519.1	0.46	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0001928.1	0.46	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001494.1	0.46	RiPP	acinetodin	Acinetobacter gyllenbergii CIP 110306
BGC0000571.1	0.46	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0001639.1	0.46	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000501.1	0.46	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928

Similar known gene clusters

Thiopeptide predictions

No core peptides found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Thiopeptides

Core peptide predictions

No core peptides found.

NC_014306.1 - Region 5 - arylpolyene,hserlactone

Download region GenBank file

Download region SVG

Location: 1,768,025 - 1,826,428 nt. (total: 58,404 nt) Show pHMM detection rules used

hserlactone: Autoind_synth
arylpolyene: (APE_KS1 or APE_KS2)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002008.1	0.50	Other	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.1	0.46	Other	APE Ec	Escherichia coli CFT073
BGC0000837.1	0.33	Other	APE Vf	Aliivibrio fischeri ES114
BGC0001480.1	0.26	Other	tundrenone	Methylobacter tundripaludum 21/22
BGC0000195.1	0.26	Polyketide	alnumycin A, alnumycin B, alnumycin C, alnumycin P, prealnumycin, thalnumycin A, thalnumycin B, K1115A, 1,6-dihydro-8-propylanthraquinone	Streptomyces sp. CM020
BGC0000231.1	0.24	Polyketide	griseusin	Streptomyces griseus
BGC0001590.1	0.24	Polyketide	formicamycins A-M	Streptomyces sp. KY5
BGC0000225.1	0.23	Polyketide	frenolicin B	Streptomyces roseofulvus
BGC0001197.1	0.23	Polyketide	frankiamicin	Frankia sp. EAN1pec
BGC0001897.1	0.22	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002008.1	0.79	Other	aryl polyenes	Xenorhabdus doucetiae
BGC0000836.1	0.76	Other	APE Ec	Escherichia coli CFT073
BGC0000837.1	0.67	Other	APE Vf	Aliivibrio fischeri ES114
BGC0001897.1	0.61	Polyketide	cepacin A	Burkholderia ambifaria IOP40-10
BGC0002012.1	0.59	Polyketide	julichrome Q3-3, julichrome Q3-5	Streptomyces afghaniensis 772
BGC0001343.1	0.58	Polyketide	aurachin A, aurachin D	Stigmatella aurantiaca Sg a15
BGC0000231.1	0.57	Polyketide	griseusin	Streptomyces griseus
BGC0000873.1	0.56	Other	A-201A	Saccharothrix mutabilis subsp. capreolus
BGC0000225.1	0.56	Polyketide	frenolicin B	Streptomyces roseofulvus
BGC0001197.1	0.56	Polyketide	frankiamicin	Frankia sp. EAN1pec

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NC_014306.1 - Region 6 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 2,516,085 - 2,538,868 nt. (total: 22,784 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001364.1	0.27	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001184.1	0.22	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.22	Other	bacilysin	Bacillus sp. CS93
BGC0000204.1	0.17	Polyketide	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002016.1	0.17	Polyketide	lugdunomycin	Streptomyces sp. QL37
BGC0000847.1	0.15	Other (Non-NRP beta-lactam)	thienamycin	Streptomyces cattleya
BGC0001177.1	0.15	Polyketide	mensacaricin	Streptomyces bottropensis
BGC0000804.1	0.14	Saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001927.1	0.14	Other	A-94964	Streptomyces sp.
BGC0001150.1	0.14	Polyketide	pamamycin-607	Streptomyces alboniger

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001364.1	0.60	RiPP	cinnamycin B	Actinomadura atramentaria DSM 43919
BGC0001184.1	0.55	Other	bacilysin	Bacillus velezensis FZB42
BGC0000888.1	0.55	Other	bacilysin	Bacillus sp. CS93
BGC0000204.1	0.49	Polyketide	benastatin A, benastatin B, BE-43767, TAN1532B	Streptomyces sp. A2991200
BGC0002016.1	0.49	Polyketide	lugdunomycin	Streptomyces sp. QL37
BGC0000847.1	0.46	Other (Non-NRP beta-lactam)	thienamycin	Streptomyces cattleya
BGC0001177.1	0.45	Polyketide	mensacaricin	Streptomyces bottropensis
BGC0000804.1	0.44	Saccharide	acarviostatin I03, acarviostatin II03, acarviostatin III03, acarviostatin IV03	Streptomyces coelicoflavus ZG0656
BGC0001927.1	0.44	Other	A-94964	Streptomyces sp.
BGC0001150.1	0.44	Polyketide	pamamycin-607	Streptomyces alboniger

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_2282 - Putative Class II

ctg1_2283 leader / core peptide: MEQINAETNEILECNLEEFGNVEDSLESVKHHQENFM - CDhbELGCCDhaIIDhbDhaDhbLY
allorf_2538546_2538659 leader / core peptide: VTSSTKLADRQRFILKALTFS - LDhbDFCNRLLLDhbDhaYYQI

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_2283 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1515.7 Da

Molecular weight: 1516.8 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 1534.8 Da N = 1; 1552.8 Da N = 2

allorf_2538546_2538659 - Class II

Cleavage pHMM score: -5.40

RODEO score: 0

Monoisotopic mass: 1908.0 Da

Molecular weight: 1909.2 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1927.2 Da N = 1; 1945.2 Da N = 2

NC_014306.1 - Region 7 - siderophore

Download region GenBank file

Download region SVG

Location: 2,810,984 - 2,823,335 nt. (total: 12,352 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.1	0.63	Other	desferrioxamine E	Pantoea agglomerans
BGC0001478.1	0.30	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.28	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.1	0.27	Other	desferrioxamine	Streptomyces argillaceus
BGC0000940.1	0.27	Other	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001713.1	0.21	Other	ochrobactin	Ochrobactrum anthropi
BGC0000295.1	0.20	NRP	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.1	0.19	Other	aerobactin	Pantoea ananatis
BGC0000939.1	0.17	Other	aerobactin	Grimontia hollisae
BGC0001498.1	0.17	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001572.1	0.85	Other	desferrioxamine E	Pantoea agglomerans
BGC0001478.1	0.64	Other	desferrioxamine E	Streptomyces sp. ID38640
BGC0000941.1	0.61	Other	desferrioxamin B	Streptomyces griseus subsp. griseus NBRC 13350
BGC0001453.1	0.60	Other	desferrioxamine	Streptomyces argillaceus
BGC0000940.1	0.60	Other	desferrioxamin B, desferrioxamine E	Streptomyces coelicolor A3(2)
BGC0001713.1	0.54	Other	ochrobactin	Ochrobactrum anthropi
BGC0000295.1	0.52	NRP	acinetoferrin	Acinetobacter haemolyticus
BGC0001499.1	0.51	Other	aerobactin	Pantoea ananatis
BGC0000939.1	0.49	Other	aerobactin	Grimontia hollisae
BGC0001498.1	0.48	Other	aerobactin	Xenorhabdus szentirmaii DSM 16338

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NC_014306.1 - Region 8 - RRE-containing

Download region GenBank file

Download region SVG

Location: 4,185,510 - 4,205,794 nt. (total: 20,285 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001929.1	0.13	RiPP	WGK	Streptococcus ferus
BGC0000506.1	0.13	RiPP	entianin	Bacillus subtilis subsp. spizizenii
BGC0000905.1	0.13	Other	heme D1	Heliobacillus mobilis
BGC0000883.1	0.13	Other	arginomycin	Streptomyces arginensis
BGC0001446.1	0.11	Polyketide	asparasone A	Aspergillus flavus NRRL3357
BGC0001365.1	0.08	NRP	clapurines	Claviceps purpurea 20.1
BGC0000814.1	0.08	Alkaloid	K-252a	Nonomuraea longicatena
BGC0001791.1	0.08	NRP	sunshinamide	Gynuella sunshinyii YC6258
BGC0000949.1	0.08	NRP	A-500359 A, A-500359 B	Streptomyces griseus
BGC0001100.1	0.08	NRP, Polyketide	lankacidin C	Streptomyces rochei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001929.1	0.42	RiPP	WGK	Streptococcus ferus
BGC0000506.1	0.42	RiPP	entianin	Bacillus subtilis subsp. spizizenii
BGC0000905.1	0.42	Other	heme D1	Heliobacillus mobilis
BGC0000883.1	0.41	Other	arginomycin	Streptomyces arginensis
BGC0001446.1	0.37	Polyketide	asparasone A	Aspergillus flavus NRRL3357
BGC0001365.1	0.32	NRP	clapurines	Claviceps purpurea 20.1
BGC0000814.1	0.32	Alkaloid	K-252a	Nonomuraea longicatena
BGC0001791.1	0.32	NRP	sunshinamide	Gynuella sunshinyii YC6258
BGC0000949.1	0.31	NRP	A-500359 A, A-500359 B	Streptomyces griseus
BGC0001100.1	0.31	NRP, Polyketide	lankacidin C	Streptomyces rochei

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names