GCF_900637985.1_54949_H01_genomic - 2 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LR134479.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	lassopeptide,lanthipeptide-class-ii	246,015	287,919
Region 2	NRPS	1,575,724	1,619,980	steffimycin D	Polyketide:Type II + Saccharide:Hybrid/tailoring	8%

NZ_LR134479.1 - Region 1 - lanthipeptide-class-ii,lassopeptide

Download region GenBank file

Download region SVG

Location: 246,015 - 287,919 nt. (total: 41,905 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Lasso peptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.47	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001311.1	0.45	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0001550.1	0.45	RiPP	citrulassin D	Streptomyces katrae
BGC0000575.1	0.45	RiPP	lariatin	Rhodococcus jostii
BGC0000552.1	0.44	RiPP	SmbA, SmbB	Streptococcus mutans
BGC0001549.1	0.44	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0000555.1	0.43	RiPP	staphylococcin C55 α, staphylococcin C55 β	Staphylococcus aureus
BGC0001210.1	0.43	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001576.1	0.43	RiPP	divamide A	Prochloron didemni
BGC0000500.1	0.42	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001550.1	0.66	RiPP	citrulassin D	Streptomyces katrae
BGC0000575.1	0.66	RiPP	lariatin	Rhodococcus jostii
BGC0000554.1	0.66	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001549.1	0.65	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001552.1	0.65	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001655.1	0.64	RiPP	LP2006	Nocardiopsis alba DSM 43377
BGC0001391.1	0.64	RiPP	thusin	Bacillus thuringiensis serovar rongseni
BGC0001779.1	0.63	RiPP	siamycin	Streptomyces nodosus
BGC0001311.1	0.63	RiPP	flavecins	Ruminococcus flavefaciens FD-1
BGC0001889.1	0.63	RiPP	fusilassin	Thermobifida fusca YX

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_264 - Putative Class II

ctg1_263 leader / core peptide: MAKDTMFMEELTDQELEQVNGG - CYDhaDhaCGYYGGDhaYGGDhaYGGDhaYGGDhaDhaDhaDhaYYGGDhaYDhaGGGYYYAAVGYGYDhaC
ctg1_265 leader / core peptide: MPKDITLLEEISDQELGQVNGG - GDhaHGGGYYDhaDhaVGGGDhaYGGGYCGGGCGGYGYGFGFWGGDhaFDha
allorf_0265595_0265780 leader / core peptide: VTKYCMSHAKYYGA - EDhaQKLMFVIYCDhaPPDhaARGYDhbQNARIMDhaPGVKLWLAGRQPDhaPVAGCPR
allorf_0269996_0270211 leader / core peptide: LEIMMRTYCILPRWFDTVEGLARVAISLLQGRELIVGVLLRMQRMDSIESFRKLILGS - YCVIGDhbVLHDhaHIDha

Lanthipeptide(s) for ctg1_266 - Putative Class II

ctg1_263 leader / core peptide: MAKDTMFMEELTDQELEQVNGG - CYDhaDhaCGYYGGDhaYGGDhaYGGDhaYGGDhaDhaDhaDhaYYGGDhaYDhaGGGYYYAAVGYGYDhaC
ctg1_265 leader / core peptide: MPKDITLLEEISDQELGQVNGG - GDhaHGGGYYDhaDhaVGGGDhaYGGGYCGGGCGGYGYGFGFWGGDhaFDha
allorf_0265595_0265780 leader / core peptide: VTKYCMSHAKYYGA - EDhaQKLMFVIYCDhaPPDhaARGYDhbQNARIMDhaPGVKLWLAGRQPDhaPVAGCPR
allorf_0269996_0270211 leader / core peptide: LEIMMRTYCILPRWFDTVEGLARVAISLLQGRELIVGVLLRMQRMDSIESFRKLILGS - YCVIGDhbVLHDhaHIDha
allorf_0265627_0265695 leader / core peptide: VYPLADGGEQYM - DhbNINFCDDhaAP
allorf_0265696_0265836 leader / core peptide: LCRWRIRAVLAS - CDhaLKPDHHLGHPADhbGEGCRPADhaQDhaFDhbPGLIILAF
allorf_0265791_0265895 leader / core peptide: VFLHPARRLLIGG - GLLGVPDhaCAGGAFAPYLLRVP
allorf_0270096_0270281 leader / core peptide: LLCALIALYYG - HHIDhbKWCDIKWKLRICEDhaVKLFLDhaHNRDhaPIDhaAFGDhaDhaQCYPFFADhaDhaIEHPQ
allorf_0270410_0270481 leader / core peptide: VVENRDLASS - DhaPKHDhaDhbIKNCDhaRK

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lasso peptide predictions

Lassopeptide(s) for allorf_0255011_0255136 - Putative Class II

allorf_0255011_0255136 leader / core peptide / cleaved tail: LDNAMYTKATFTKITSFRAATH - GWYWGNRRDIYGALRYANK

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Lasso peptides

Core peptide predictions

ctg1_263 - Class II

Cleavage pHMM score: 4.70

RODEO score: 0

Monoisotopic mass: 4591.8 Da

Molecular weight: 4594.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4612.7 Da N = 1; 4630.7 Da N = 2; 4648.7 Da N = 3; 4666.7 Da N = 4; 4684.8 Da N = 5; 4702.8 Da N = 6; 4720.8 Da N = 7; 4738.8 Da N = 8; 4756.8 Da N = 9

ctg1_265 - Class II

Cleavage pHMM score: 3.20

RODEO score: 0

Monoisotopic mass: 3620.4 Da

Molecular weight: 3622.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3640.7 Da N = 1; 3658.8 Da N = 2; 3676.8 Da N = 3; 3694.8 Da N = 4

allorf_0265595_0265780 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 5038.6 Da

Molecular weight: 5041.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 5059.9 Da N = 1; 5077.9 Da N = 2; 5095.9 Da N = 3; 5114.0 Da N = 4

allorf_0269996_0270211 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 1373.7 Da

Molecular weight: 1374.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1392.6 Da N = 1; 1410.6 Da N = 2

ctg1_263 - Class II

Cleavage pHMM score: 4.70

RODEO score: 0

Monoisotopic mass: 4591.8 Da

Molecular weight: 4594.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 4612.7 Da N = 1; 4630.7 Da N = 2; 4648.7 Da N = 3; 4666.7 Da N = 4; 4684.8 Da N = 5; 4702.8 Da N = 6; 4720.8 Da N = 7; 4738.8 Da N = 8; 4756.8 Da N = 9

ctg1_265 - Class II

Cleavage pHMM score: 3.20

RODEO score: 0

Monoisotopic mass: 3620.4 Da

Molecular weight: 3622.7 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3640.7 Da N = 1; 3658.8 Da N = 2; 3676.8 Da N = 3; 3694.8 Da N = 4

allorf_0265595_0265780 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 5038.6 Da

Molecular weight: 5041.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 5059.9 Da N = 1; 5077.9 Da N = 2; 5095.9 Da N = 3; 5114.0 Da N = 4

allorf_0269996_0270211 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 1373.7 Da

Molecular weight: 1374.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1392.6 Da N = 1; 1410.6 Da N = 2

allorf_0265627_0265695 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 1044.5 Da

Molecular weight: 1045.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1063.1 Da N = 1

allorf_0265696_0265836 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 3466.8 Da

Molecular weight: 3468.9 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 3487.0 Da N = 1; 3505.0 Da N = 2; 3523.0 Da N = 3

allorf_0265791_0265895 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 2039.1 Da

Molecular weight: 2040.4 Da

Number of bridges: 1

allorf_0270096_0270281 - Class II

Cleavage pHMM score: -6.10

RODEO score: 0

Monoisotopic mass: 5695.9 Da

Molecular weight: 5699.5 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 5717.5 Da N = 1; 5735.6 Da N = 2; 5753.6 Da N = 3; 5771.6 Da N = 4; 5789.6 Da N = 5; 5807.6 Da N = 6

allorf_0270410_0270481 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 1412.8 Da

Molecular weight: 1413.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1431.7 Da N = 1; 1449.7 Da N = 2; 1467.7 Da N = 3

Core peptide predictions

allorf_0255011_0255136 - Class II: Cleavage pHMM score: -5.50; RODEO score: 19; Monoisotopic mass: 2340.2 Da; Molecular weight: 2341.6 Da; Number of bridges: 0

NZ_LR134479.1 - Region 2 - NRPS

Download region GenBank file

Download region SVG

Location: 1,575,724 - 1,619,980 nt. (total: 44,257 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

NRPS/PKS modules

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001615.1	0.33	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0001437.1	0.28	NRP	obafluorin	Pseudomonas fluorescens
BGC0001710.1	0.28	NRP	obafluorin	Pseudomonas fluorescens
BGC0000417.1	0.26	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001833.1	0.25	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000410.1	0.24	NRP	pseudomonine	Pseudomonas fluorescens
BGC0001538.1	0.24	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0001825.1	0.24	NRP	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.1	0.24	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.1	0.23	NRP	sevadicin	Paenibacillus larvae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001615.1	0.67	NRP	hexose-palythine-serine, hexose-shinorine	Heteroscytonema crispum UCFS10
BGC0001437.1	0.62	NRP	obafluorin	Pseudomonas fluorescens
BGC0001710.1	0.62	NRP	obafluorin	Pseudomonas fluorescens
BGC0000417.1	0.60	NRP	rhodochelin	Rhodococcus jostii RHA1
BGC0001833.1	0.58	NRP	icosalide A, icosalide B	Burkholderia gladioli
BGC0000410.1	0.57	NRP	pseudomonine	Pseudomonas fluorescens
BGC0001538.1	0.57	NRP, Polyketide	caboxamycin	Streptomyces sp. NTK 937
BGC0001825.1	0.57	NRP	xenematide	Xenorhabdus nematophila AN6/1
BGC0001132.1	0.57	NRP	xenotetrapeptide	Xenorhabdus nematophila ATCC 19061
BGC0000426.1	0.56	NRP	sevadicin	Paenibacillus larvae

Similar known gene clusters

Module view

Legend

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 4, location 1575723 - 1619980:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg1_1361

Search NORINE for peptide: strict or relaxed

AMP-binding (515..966): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHVSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

ctg1_1363

Search NORINE for peptide: strict or relaxed

AMP-binding (50..465): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: TMPaQGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 90% (moderate)