GCF_900638015.1_54984_A01_genomic - 4 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_LR134483.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1	cyclic-lactone-autoinducer	24,579	44,188
Region 2	lanthipeptide-class-ii,cyclic-lactone-autoinducer	340,859	372,102
Region 3	T3PKS,ladderane	1,121,293	1,174,811	pyxidicycline A / pyxidicycline B	Polyketide	6%
Region 4	terpene	1,588,819	1,609,667	citrulline	Other	18%

NZ_LR134483.1 - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 24,579 - 44,188 nt. (total: 19,610 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000879.1	0.10	Other	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001808.1	0.09	Other	toyocamycin	Streptomyces diastatochromogenes
BGC0000881.1	0.09	Other	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001110.1	0.05	NRP, Polyketide	psymberin, irciniastatin B	uncultured bacterium psy1
BGC0001555.1	0.05	RiPP	colicin V	Escherichia coli chi7122
BGC0001370.1	0.04	NRP	lipopeptide 8D1-1, lipopeptide 8D1-2	Streptomyces rochei
BGC0001818.1	0.04	NRP	vazabitide A	Streptomyces sp. SANK 60404
BGC0000291.1	0.03	NRP	A54145	Streptomyces fradiae

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000879.1	0.36	Other	toyocamycin, sangivamycin	Streptomyces rimosus
BGC0001808.1	0.33	Other	toyocamycin	Streptomyces diastatochromogenes
BGC0000881.1	0.33	Other	toyocamycin	Streptomyces ahygroscopicus subsp. wuzhouensis
BGC0001110.1	0.24	NRP, Polyketide	psymberin, irciniastatin B	uncultured bacterium psy1
BGC0001555.1	0.22	RiPP	colicin V	Escherichia coli chi7122
BGC0001370.1	0.19	NRP	lipopeptide 8D1-1, lipopeptide 8D1-2	Streptomyces rochei
BGC0001818.1	0.19	NRP	vazabitide A	Streptomyces sp. SANK 60404
BGC0000291.1	0.16	NRP	A54145	Streptomyces fradiae

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LR134483.1 - Region 2 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 340,859 - 372,102 nt. (total: 31,244 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000554.1	0.60	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001229.1	0.59	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000539.1	0.57	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000528.1	0.55	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000500.1	0.55	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001787.1	0.53	RiPP	suicin 3908	Streptococcus suis
BGC0000516.1	0.52	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000498.1	0.52	RiPP	bovicin HJ50	Streptococcus equinus
BGC0000561.1	0.52	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0000504.1	0.48	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001229.1	0.67	RiPP	SBI-06990 A1, SBI-06989 A2	Streptomyces bingchenggensis BCW-1
BGC0000525.1	0.66	RiPP	lichenicidin VK21 A1, lichenicidin VK21 A2	Bacillus licheniformis
BGC0000539.1	0.62	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000528.1	0.61	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0000500.1	0.61	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0001787.1	0.60	RiPP	suicin 3908	Streptococcus suis
BGC0000554.1	0.60	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000498.1	0.60	RiPP	bovicin HJ50	Streptococcus equinus
BGC0000561.1	0.60	RiPP	thermophilin 1277	Streptococcus thermophilus
BGC0001660.1	0.58	RiPP	mathermycin	Marinactinospora thermotolerans

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_333 - Putative Class II

ctg1_331 leader / core peptide: MEKKEWEKTAQIVQEGFLQEVEEQEIGEESGGA - WWNVDhaKNLGNKGRICDhbLDhbKECQDhaMCN
ctg1_332 leader / core peptide: MTKKEYGLQRMSQLDQRDFLKEIEEHEKQNQVSGG - WGWKDLDhaKDhaLGNKGYVCDhbLDhbKECQKLCR
ctg1_336 leader / core peptide: MTNQKKEVMNEKEQKLEAELRELSSHEDENGG - FPWDhbVDhbVPLDhaIALCPDhbAKCDhbDhaKCR
ctg1_341 leader / core peptide: MKKLVINLFEMFGS - LNVRQCCFLLDhaDEIEIPDELAE
allorf_0347033_0347134 leader / core peptide: LGISSFRLYFLRNIFAI - NCDhaDhaYIQVFDhaYYFVLN

Lanthipeptide(s) for ctg1_337 - Putative Class II

ctg1_331 leader / core peptide: MEKKEWEKTAQIVQEGFLQEVEEQEIGEESGGA - WWNVDhaKNLGNKGRICDhbLDhbKECQDhaMCN
ctg1_332 leader / core peptide: MTKKEYGLQRMSQLDQRDFLKEIEEHEKQNQVSGG - WGWKDLDhaKDhaLGNKGYVCDhbLDhbKECQKLCR
ctg1_336 leader / core peptide: MTNQKKEVMNEKEQKLEAELRELSSHEDENGG - FPWDhbVDhbVPLDhaIALCPDhbAKCDhbDhaKCR
ctg1_341 leader / core peptide: MKKLVINLFEMFGS - LNVRQCCFLLDhaDEIEIPDELAE
allorf_0347033_0347134 leader / core peptide: LGISSFRLYFLRNIFAI - NCDhaDhaYIQVFDhaYYFVLN

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_331 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 2940.4 Da

Molecular weight: 2942.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2960.4 Da N = 1

ctg1_332 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 3171.6 Da

Molecular weight: 3173.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3191.7 Da N = 1

ctg1_336 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 2513.4 Da

Molecular weight: 2515.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2533.1 Da N = 1; 2551.1 Da N = 2; 2569.1 Da N = 3

ctg1_341 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 2530.2 Da

Molecular weight: 2531.9 Da

Number of bridges: 1

allorf_0347033_0347134 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 1891.9 Da

Molecular weight: 1893.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1911.1 Da N = 1; 1929.1 Da N = 2

ctg1_331 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 2940.4 Da

Molecular weight: 2942.4 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2960.4 Da N = 1

ctg1_332 - Class II

Cleavage pHMM score: -3.40

RODEO score: 0

Monoisotopic mass: 3171.6 Da

Molecular weight: 3173.7 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 3191.7 Da N = 1

ctg1_336 - Class II

Cleavage pHMM score: -3.70

RODEO score: 0

Monoisotopic mass: 2513.4 Da

Molecular weight: 2515.0 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2533.1 Da N = 1; 2551.1 Da N = 2; 2569.1 Da N = 3

ctg1_341 - Class II

Cleavage pHMM score: -3.80

RODEO score: 0

Monoisotopic mass: 2530.2 Da

Molecular weight: 2531.9 Da

Number of bridges: 1

allorf_0347033_0347134 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 1891.9 Da

Molecular weight: 1893.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1911.1 Da N = 1; 1929.1 Da N = 2

NZ_LR134483.1 - Region 3 - T3PKS,ladderane

Download region GenBank file

Download region SVG

Location: 1,121,293 - 1,174,811 nt. (total: 53,519 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)
ladderane: ladderane

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Detailed domain annotation

Selected features only

Show module domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.1	0.54	Other	bacilysin	Bacillus sp. CS93
BGC0001184.1	0.54	Other	bacilysin	Bacillus velezensis FZB42
BGC0000231.1	0.48	Polyketide	griseusin	Streptomyces griseus
BGC0000679.1	0.47	Terpene	diazepinomicin	Micromonospora sp. M42
BGC0000286.1	0.46	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0000255.1	0.45	Polyketide	pederin	Uncultured bacterium
BGC0000234.1	0.43	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712
BGC0000205.1	0.42	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0001723.1	0.42	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000221.1	0.42	Polyketide	erdacin	uncultured soil bacterium V167

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000888.1	0.61	Other	bacilysin	Bacillus sp. CS93
BGC0001184.1	0.61	Other	bacilysin	Bacillus velezensis FZB42
BGC0000679.1	0.59	Terpene	diazepinomicin	Micromonospora sp. M42
BGC0000231.1	0.57	Polyketide	griseusin	Streptomyces griseus
BGC0001723.1	0.57	Polyketide	oviedomycin	Streptomyces antibioticus
BGC0000221.1	0.56	Polyketide	erdacin	uncultured soil bacterium V167
BGC0000286.1	0.56	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0000255.1	0.56	Polyketide	pederin	Uncultured bacterium
BGC0001848.1	0.55	Other	diazaquinomycin H, diazaquinomycin J	Micromonospora sp. B006
BGC0000234.1	0.54	Polyketide	jadomycin	Streptomyces venezuelae ATCC 10712

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

NZ_LR134483.1 - Region 4 - terpene

Download region GenBank file

Download region SVG

Location: 1,588,819 - 1,609,667 nt. (total: 20,849 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.1	0.45	Terpene	carotenoid	Rhodobacter sphaeroides
BGC0000648.1	0.23	Terpene	carotenoid	Myxococcus xanthus
BGC0000637.1	0.22	Terpene	carotenoid	Corynebacterium glutamicum
BGC0000634.1	0.21	Terpene	carotenoid	Brevundimonas sp. SD212
BGC0000643.1	0.21	Terpene	carotenoid	Brevundimonas vesicularis
BGC0001227.1	0.20	Terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000664.1	0.20	Terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.1	0.20	Terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000633.1	0.20	Terpene	carotenoid	Streptomyces avermitilis
BGC0000630.1	0.20	Terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000647.1	0.75	Terpene	carotenoid	Rhodobacter sphaeroides
BGC0000648.1	0.56	Terpene	carotenoid	Myxococcus xanthus
BGC0000637.1	0.55	Terpene	carotenoid	Corynebacterium glutamicum
BGC0000634.1	0.54	Terpene	carotenoid	Brevundimonas sp. SD212
BGC0000643.1	0.54	Terpene	carotenoid	Brevundimonas vesicularis
BGC0001227.1	0.53	Terpene	isorenieratene	Streptomyces collinus Tu 365
BGC0000664.1	0.53	Terpene	isorenieratene	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000640.1	0.53	Terpene	carotenoid	Enterobacteriaceae bacterium DC404
BGC0000633.1	0.52	Terpene	carotenoid	Streptomyces avermitilis
BGC0000630.1	0.52	Terpene	(2R,3S,3'S)-2-hydroxyastaxanthin	Paracoccus haeundaensis

Similar known gene clusters

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names