GCF_902375605.1_MGYG-HGUT-01501_genomic - 3 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

c00010_NZ_CABK.. (original name was: NZ_CABKUO010000013.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	RiPP-like	447,597	459,816

c00011_NZ_CABK.. (original name was: NZ_CABKUO010000014.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	lanthipeptide-class-iii	821,678	844,281
Region 11.2	T3PKS	2,760,250	2,801,422

Region	Type	From	To	Similarity
Region 10.1	RiPP-like	447,597	459,816
Region 11.1	lanthipeptide-class-iii	821,678	844,281
Region 11.2	T3PKS	2,760,250	2,801,422

No secondary metabolite regions were found in these records:: c00001_NZ_CABK.. (original name was: NZ_CABKUO010000004.1); c00002_NZ_CABK.. (original name was: NZ_CABKUO010000005.1); c00003_NZ_CABK.. (original name was: NZ_CABKUO010000006.1); c00004_NZ_CABK.. (original name was: NZ_CABKUO010000007.1); c00005_NZ_CABK.. (original name was: NZ_CABKUO010000008.1); c00006_NZ_CABK.. (original name was: NZ_CABKUO010000009.1); c00007_NZ_CABK.. (original name was: NZ_CABKUO010000010.1); c00008_NZ_CABK.. (original name was: NZ_CABKUO010000011.1); c00009_NZ_CABK.. (original name was: NZ_CABKUO010000012.1)

Compact view

c00010_NZ_CABK.. - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 447,597 - 459,816 nt. (total: 12,220 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.1	0.24	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000554.1	0.21	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000617.1	0.20	RiPP	coagulin	Bacillus coagulans
BGC0000624.1	0.17	RiPP	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0001862.1	0.16	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.16	RiPP	pallidocin	Aeribacillus pallidus
BGC0001863.1	0.16	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001861.1	0.16	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000484.1	0.15	RiPP	glycocin F	Lactobacillus plantarum
BGC0000516.1	0.15	RiPP	geobacillin II	Geobacillus thermodenitrificans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000558.1	0.57	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000554.1	0.54	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000617.1	0.52	RiPP	coagulin	Bacillus coagulans
BGC0000624.1	0.49	RiPP	salivaricin CRL1328 α peptide, salivaricin CRL1328 β peptide	Lactobacillus salivarius
BGC0001862.1	0.47	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.47	RiPP	pallidocin	Aeribacillus pallidus
BGC0001863.1	0.46	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001861.1	0.46	RiPP	bacillicin BAG2O	Bacillus cereus BAG2O-1
BGC0000484.1	0.45	RiPP	glycocin F	Lactobacillus plantarum
BGC0000516.1	0.45	RiPP	geobacillin II	Geobacillus thermodenitrificans

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00011_NZ_CABK.. - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 821,678 - 844,281 nt. (total: 22,604 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.1	0.31	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000563.1	0.31	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000553.1	0.27	RiPP	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.1	0.25	RiPP	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001579.1	0.24	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000551.1	0.23	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000518.1	0.22	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001576.1	0.21	RiPP	divamide A	Prochloron didemni
BGC0000554.1	0.20	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000523.1	0.20	RiPP	lactocin S	Lactobacillus sakei

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000501.1	0.65	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000563.1	0.65	RiPP	venezuelin	Streptomyces venezuelae ATCC 10712
BGC0000553.1	0.61	RiPP	SRO15-2212	Streptomyces filamentosus NRRL 15998
BGC0000513.1	0.59	RiPP	Ery-9, Ery-6, Ery-8, Ery-7, Ery-5, Ery-4, Ery-3	Saccharopolyspora erythraea NRRL 2338
BGC0001579.1	0.57	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000551.1	0.56	RiPP	SapB	Streptomyces coelicolor A3(2)
BGC0000518.1	0.55	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0001576.1	0.54	RiPP	divamide A	Prochloron didemni
BGC0000554.1	0.53	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000523.1	0.52	RiPP	lactocin S	Lactobacillus sakei

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg11_727 - Putative Class III

ctg11_728 leader / core peptide: MKDVLELQQLNEGSEVE - PAKWYDhbIFDhbDhbLIGDhbDhaDhbIDhaNNCGK
ctg11_729 leader / core peptide: MKDVLELQQLNEGSEVE - PAKWYDhbIFDhbDhbLIGDhbDhaDhbIDhaNNCR
ctg11_732 leader / core peptide: MKKVLELQKLNDNSEVQ - PQIGPDhbIDhbDhbIDhbIIPDhbDhbLVDhaFLDhaNYCDNHVDha
allorf_0834375_0834536 leader / core peptide: MRTINILELKGGEKVESVLELQKLNEDPEVE - DhbAGWWFDhbDhaVDhbLLVDhbDhbDhaDhbIDhaNHC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg11_728 - Class III

Cleavage pHMM score: -1.00

RODEO score: 0

Monoisotopic mass: 2389.3 Da

Molecular weight: 2390.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2408.7 Da N = 1; 2426.8 Da N = 2; 2444.8 Da N = 3; 2462.8 Da N = 4; 2480.8 Da N = 5; 2498.8 Da N = 6

ctg11_729 - Class III

Cleavage pHMM score: -1.00

RODEO score: 0

Monoisotopic mass: 2360.3 Da

Molecular weight: 2361.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2379.7 Da N = 1; 2397.7 Da N = 2; 2415.7 Da N = 3; 2433.8 Da N = 4; 2451.8 Da N = 5; 2469.8 Da N = 6

ctg11_732 - Class III

Cleavage pHMM score: -2.50

RODEO score: 0

Monoisotopic mass: 3082.7 Da

Molecular weight: 3084.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3102.5 Da N = 1; 3120.5 Da N = 2; 3138.6 Da N = 3; 3156.6 Da N = 4; 3174.6 Da N = 5; 3192.6 Da N = 6; 3210.6 Da N = 7; 3228.7 Da N = 8

allorf_0834375_0834536 - Class III

Cleavage pHMM score: -0.10

RODEO score: 0

Monoisotopic mass: 2262.2 Da

Molecular weight: 2263.5 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 2281.6 Da N = 1; 2299.6 Da N = 2; 2317.6 Da N = 3; 2335.6 Da N = 4; 2353.6 Da N = 5; 2371.7 Da N = 6; 2389.7 Da N = 7; 2407.7 Da N = 8

c00011_NZ_CABK.. - Region 2 - T3PKS

Download region GenBank file

Download region SVG

Location: 2,760,250 - 2,801,422 nt. (total: 41,173 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.1	0.23	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0000867.1	0.19	Other	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000866.1	0.19	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000495.1	0.18	RiPP	actagardine	Actinoplanes garbadinensis
BGC0001739.1	0.16	Other	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001104.1	0.16	NRP, Polyketide	myxovirescin A1	Myxococcus xanthus DK 1622
BGC0000205.1	0.16	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0000487.1	0.16	RiPP	carnocyclin	Carnobacterium maltaromaticum
BGC0000521.1	0.16	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000626.1	0.16	RiPP	thuricin	Bacillus thuringiensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000286.1	0.56	Polyketide	viguiepinol	Streptomyces sp. KO-3988
BGC0000867.1	0.51	Other	polyhydroxyalkanoic acids	Ectothiorhodospira shaposhnikovii
BGC0000866.1	0.50	Other	polyhydroxyalkanoate	Burkholderia sp. DSM 9242
BGC0000495.1	0.50	RiPP	actagardine	Actinoplanes garbadinensis
BGC0001739.1	0.47	Other	phosphonoacetic Acid	Streptomyces sp. NRRL F-525
BGC0001104.1	0.46	NRP, Polyketide	myxovirescin A1	Myxococcus xanthus DK 1622
BGC0000205.1	0.46	Polyketide	bryostatin	Candidatus Endobugula sertula
BGC0000487.1	0.46	RiPP	carnocyclin	Carnobacterium maltaromaticum
BGC0000521.1	0.46	RiPP	lacticin 481	Lactococcus lactis subsp. lactis
BGC0000626.1	0.46	RiPP	thuricin	Bacillus thuringiensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names