GCF_000393015.1_Ente_faec_T5_V1_genomic - 2 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

NZ_KB944666.1

Region	Type	From	To	Most similar known cluster		Similarity
Region 1.1	lanthipeptide-class-ii	90,666	113,650
Region 1.2	cyclic-lactone-autoinducer	1,875,595	1,896,323

Region	Type	From	To	Most similar known cluster	Similarity
Region 1.1	lanthipeptide-class-ii	90,666	113,650
Region 1.2	cyclic-lactone-autoinducer	1,875,595	1,896,323

No secondary metabolite regions were found in these records:: NZ_KB944667.1; NZ_KB944668.1

Compact view

NZ_KB944666.1 - Region 1 - lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 90,666 - 113,650 nt. (total: 22,985 nt) Show pHMM detection rules used

lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.23	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000539.1	0.23	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000558.1	0.22	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000527.1	0.22	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000516.1	0.21	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0001863.1	0.20	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001862.1	0.20	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.20	RiPP	pallidocin	Aeribacillus pallidus
BGC0000484.1	0.20	RiPP	glycocin F	Lactobacillus plantarum
BGC0000547.1	0.20	RiPP	salivaricin 9	Streptococcus salivarius

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000504.1	0.56	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000539.1	0.56	RiPP	nukacin ISK-1	Staphylococcus warneri
BGC0000558.1	0.55	RiPP	sublancin 168	Bacillus subtilis subsp. subtilis str. 168
BGC0000527.1	0.55	RiPP	mersacidin	Bacillus sp. HIL-Y85/54728
BGC0000516.1	0.54	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0001863.1	0.53	RiPP, Terpene	bacillicn CER074	Bacillus mycoides
BGC0001862.1	0.52	RiPP	geocillicin	Aeribacillus pallidus
BGC0001930.1	0.52	RiPP	pallidocin	Aeribacillus pallidus
BGC0000484.1	0.52	RiPP	glycocin F	Lactobacillus plantarum
BGC0000547.1	0.52	RiPP	salivaricin 9	Streptococcus salivarius

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg1_91 - Putative Class II

ctg1_92 leader / core peptide: LDEKQLDSLVGQKFEDLSKEEMNFIAGG - NDNARIDhaPDhbIILDhaAADhbVADhaAADhaDhaFVGDhaYDhbLDhaAFDhbKCR
ctg1_93 leader / core peptide: MEAEKIVGM - QFEDLDhaKEEMNFIAGGNNNARIDhaPDhbIVDhbPVDhbPYDhbDhaYVADhaAAGDhaAALDhaAVDhaGLVDhaYDhbKKCF
allorf_0096672_0096836 leader / core peptide: LFSDFCHYNKLFFINGA - LMDhbYWKYLYHNFRIDhbNIDhaQYDhaIVDhaNDhaIALFNNFDhaICDha
allorf_0096922_0097065 leader / core peptide: MLLLIKTYNYLHSYFILKKYGPVNTSLVHIGGA - PRNICDhbENDhaDDhaDYL

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg1_92 - Class II

Cleavage pHMM score: -0.50

RODEO score: 0

Monoisotopic mass: 3591.9 Da

Molecular weight: 3594.0 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 3612.0 Da N = 1; 3630.1 Da N = 2; 3648.1 Da N = 3; 3666.1 Da N = 4; 3684.1 Da N = 5; 3702.1 Da N = 6; 3720.2 Da N = 7; 3738.2 Da N = 8; 3756.2 Da N = 9; 3774.2 Da N = 10

ctg1_93 - Class II

Cleavage pHMM score: 1.60

RODEO score: 0

Monoisotopic mass: 6038.1 Da

Molecular weight: 6041.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6059.7 Da N = 1; 6077.8 Da N = 2; 6095.8 Da N = 3; 6113.8 Da N = 4; 6131.8 Da N = 5; 6149.8 Da N = 6; 6167.9 Da N = 7; 6185.9 Da N = 8; 6203.9 Da N = 9; 6221.9 Da N = 10; 6239.9 Da N = 11; 6258.0 Da N = 12

allorf_0096672_0096836 - Class II

Cleavage pHMM score: -6.00

RODEO score: 0

Monoisotopic mass: 4306.2 Da

Molecular weight: 4308.9 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 4326.9 Da N = 1; 4344.9 Da N = 2; 4363.0 Da N = 3; 4381.0 Da N = 4; 4399.0 Da N = 5; 4417.0 Da N = 6; 4435.0 Da N = 7

allorf_0096922_0097065 - Class II

Cleavage pHMM score: -4.70

RODEO score: 0

Monoisotopic mass: 1571.7 Da

Molecular weight: 1572.6 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 1590.7 Da N = 1; 1608.7 Da N = 2

NZ_KB944666.1 - Region 2 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 1,875,595 - 1,896,323 nt. (total: 20,729 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001291.1	0.19	RiPP	enterocin NKR-5-3B	Enterococcus faecium
BGC0001150.1	0.14	Polyketide	pamamycin-607	Streptomyces alboniger
BGC0001783.1	0.14	Other	streptonigrin	Streptomyces flocculus
BGC0001156.1	0.14	Terpene	platencin	Streptomyces platensis
BGC0001140.1	0.14	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0000466.1	0.14	NRP	yatakemycin	Streptomyces sp. TP-A2060
BGC0000207.1	0.14	Polyketide	chartreusin	Streptomyces chartreusis
BGC0000046.1	0.11	Polyketide	depudecin	Alternaria brassicicola
BGC0001948.1	0.11	Other	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001366.1	0.06	Polyketide	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001291.1	0.51	RiPP	enterocin NKR-5-3B	Enterococcus faecium
BGC0001150.1	0.44	Polyketide	pamamycin-607	Streptomyces alboniger
BGC0001783.1	0.44	Other	streptonigrin	Streptomyces flocculus
BGC0001156.1	0.43	Terpene	platencin	Streptomyces platensis
BGC0001140.1	0.43	Terpene	platensimycin, platencin	Streptomyces platensis
BGC0000466.1	0.43	NRP	yatakemycin	Streptomyces sp. TP-A2060
BGC0000207.1	0.43	Polyketide	chartreusin	Streptomyces chartreusis
BGC0000046.1	0.37	Polyketide	depudecin	Alternaria brassicicola
BGC0001948.1	0.37	Other	naseseazine C, C3-aryl pyrroloindolines	Streptomyces sp.
BGC0001366.1	0.27	Polyketide	BE-24566B, zunyimycin A	Streptomyces sp. FJS31-2

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names