GCF_019734885.1_ASM1973488v1_genomic - 10 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

c00003_NZ_JAAX.. (original name was: NZ_JAAXCM010000062.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 3.1	lanthipeptide-class-ii,cyclic-lactone-autoinducer	70,455	100,844	bacitracin	NRP	22%

c00005_NZ_JAAX.. (original name was: NZ_JAAXCM010000038.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	ranthipeptide	24,143	45,828

c00011_NZ_JAAX.. (original name was: NZ_JAAXCM010000020.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 11.1	cyclic-lactone-autoinducer	192	10,752
Region 11.2	cyclic-lactone-autoinducer	305,038	325,586

c00017_NZ_JAAX.. (original name was: NZ_JAAXCM010000018.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 17.1	RRE-containing	18,646	38,939

c00033_NZ_JAAX.. (original name was: NZ_JAAXCM010000023.1)

Region	Type	From	To
Region 33.1	RRE-containing	1	11,874
Region 33.2	RRE-containing	118,203	139,174
Region 33.3	cyclic-lactone-autoinducer	180,483	201,218

c00050_NZ_JAAX.. (original name was: NZ_JAAXCM010000034.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 50.1	ranthipeptide	103,431	132,066

c00053_NZ_JAAX.. (original name was: NZ_JAAXCM010000029.1)

Region	Type	From	To	Most similar known cluster		Similarity
Region 53.1	RRE-containing	5,875	26,132

No secondary metabolite regions were found in these records:: c00001_NZ_JAAX.. (original name was: NZ_JAAXCM010000047.1); c00002_NZ_JAAX.. (original name was: NZ_JAAXCM010000039.1); c00004_NZ_JAAX.. (original name was: NZ_JAAXCM010000046.1); c00006_NZ_JAAX.. (original name was: NZ_JAAXCM010000049.1); c00007_NZ_JAAX.. (original name was: NZ_JAAXCM010000048.1); c00008_NZ_JAAX.. (original name was: NZ_JAAXCM010000010.1); c00009_NZ_JAAX.. (original name was: NZ_JAAXCM010000065.1); c00010_NZ_JAAX.. (original name was: NZ_JAAXCM010000061.1); c00012_NZ_JAAX.. (original name was: NZ_JAAXCM010000050.1); c00013_NZ_JAAX.. (original name was: NZ_JAAXCM010000033.1); c00014_NZ_JAAX.. (original name was: NZ_JAAXCM010000041.1); c00015_NZ_JAAX.. (original name was: NZ_JAAXCM010000045.1); c00016_NZ_JAAX.. (original name was: NZ_JAAXCM010000055.1); c00018_NZ_JAAX.. (original name was: NZ_JAAXCM010000028.1); c00019_NZ_JAAX.. (original name was: NZ_JAAXCM010000026.1); c00020_NZ_JAAX.. (original name was: NZ_JAAXCM010000017.1); c00021_NZ_JAAX.. (original name was: NZ_JAAXCM010000042.1); c00022_NZ_JAAX.. (original name was: NZ_JAAXCM010000021.1); c00023_NZ_JAAX.. (original name was: NZ_JAAXCM010000030.1); c00024_NZ_JAAX.. (original name was: NZ_JAAXCM010000037.1); c00025_NZ_JAAX.. (original name was: NZ_JAAXCM010000014.1); c00026_NZ_JAAX.. (original name was: NZ_JAAXCM010000012.1); c00027_NZ_JAAX.. (original name was: NZ_JAAXCM010000025.1); c00028_NZ_JAAX.. (original name was: NZ_JAAXCM010000019.1); c00029_NZ_JAAX.. (original name was: NZ_JAAXCM010000040.1); c00030_NZ_JAAX.. (original name was: NZ_JAAXCM010000035.1); c00031_NZ_JAAX.. (original name was: NZ_JAAXCM010000011.1); c00032_NZ_JAAX.. (original name was: NZ_JAAXCM010000016.1); c00034_NZ_JAAX.. (original name was: NZ_JAAXCM010000009.1); c00035_NZ_JAAX.. (original name was: NZ_JAAXCM010000008.1); c00036_NZ_JAAX.. (original name was: NZ_JAAXCM010000063.1); c00037_NZ_JAAX.. (original name was: NZ_JAAXCM010000044.1); c00038_NZ_JAAX.. (original name was: NZ_JAAXCM010000007.1); c00039_NZ_JAAX.. (original name was: NZ_JAAXCM010000015.1); c00040_NZ_JAAX.. (original name was: NZ_JAAXCM010000002.1); c00041_NZ_JAAX.. (original name was: NZ_JAAXCM010000004.1); c00042_NZ_JAAX.. (original name was: NZ_JAAXCM010000003.1); c00043_NZ_JAAX.. (original name was: NZ_JAAXCM010000013.1); c00044_NZ_JAAX.. (original name was: NZ_JAAXCM010000064.1); c00045_NZ_JAAX.. (original name was: NZ_JAAXCM010000027.1); c00046_NZ_JAAX.. (original name was: NZ_JAAXCM010000006.1); c00047_NZ_JAAX.. (original name was: NZ_JAAXCM010000001.1); c00048_NZ_JAAX.. (original name was: NZ_JAAXCM010000052.1); c00049_NZ_JAAX.. (original name was: NZ_JAAXCM010000005.1); c00051_NZ_JAAX.. (original name was: NZ_JAAXCM010000031.1); c00052_NZ_JAAX.. (original name was: NZ_JAAXCM010000032.1)

Compact view

c00003_NZ_JAAX.. - Region 1 - cyclic-lactone-autoinducer,lanthipeptide-class-ii

Download region GenBank file

Download region SVG

Location: 70,455 - 100,844 nt. (total: 30,390 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-ii: cds(LANC_like and DUF4135)
cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Lanthipeptides

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000780.1	0.35	Saccharide	O&K-antigen	Vibrio parahaemolyticus
BGC0000528.1	0.35	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001579.1	0.33	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000503.1	0.30	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0000554.1	0.28	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000783.1	0.28	Saccharide	O-antigen	Xanthomonas oryzae pv. oryzae
BGC0001787.1	0.27	RiPP	suicin 3908	Streptococcus suis
BGC0000626.1	0.25	RiPP	thuricin	Bacillus thuringiensis
BGC0000486.1	0.22	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000516.1	0.22	RiPP	geobacillin II	Geobacillus thermodenitrificans

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000528.1	0.68	RiPP	michiganin A	Clavibacter michiganensis subsp. michiganensis NCPPB 382
BGC0001579.1	0.66	RiPP	duramycin	Streptomyces cinnamoneus
BGC0000503.1	0.63	RiPP	cinnamycin	Streptomyces cinnamoneus
BGC0000554.1	0.62	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001787.1	0.61	RiPP	suicin 3908	Streptococcus suis
BGC0000626.1	0.59	RiPP	thuricin	Bacillus thuringiensis
BGC0000516.1	0.55	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000504.1	0.55	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0000500.1	0.55	RiPP	carnolysin A1, carnolysin A2	Carnobacterium maltaromaticum
BGC0000617.1	0.53	RiPP	coagulin	Bacillus coagulans

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg3_62 - Putative Class II

ctg3_61 leader / core peptide: MSRNVKNWKLPVYEMNEVESSNPAGNSFQELKEMELEDYTGA - GDhbANDhbHCNCYDhaEDADhaCGRLCDhbGDhbAECPIMDhbIICC
allorf_093163_093369 leader / core peptide: MVRFEGAKNIFGS - LVVDhbDhbKDhbGIPVKIVFVRNRNKKDhaECLYLLDhaDhbDVDhaLDhaDAEIVRIYGNIWQVMPIDhaA
allorf_072089_072178 leader / core peptide: MKAHKYWSLGALASMIGT - FYCFDhaRYEICDha
allorf_076310_076468 leader / core peptide: VQKYSRLFCSVSIFEVLLQSLSLHFPPFMFITTIIKHQPCHNLAEILFL - DhaCF
allorf_093304_093480 leader / core peptide: LWIKINADSLLTM - PDIGDhaGMEDhaYRNFIGIDhaKIDhaAYGRLCRYRHNLPYVDhaINPYDLDhaIDhb
allorf_093330_093434 leader / core peptide: LGQAWNLIEILSA - FLKYRHMAGYADIGIDhbCHMFP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

Lanthipeptides

Core peptide predictions

ctg3_61 - Class II

Cleavage pHMM score: 0.20

RODEO score: 0

Monoisotopic mass: 3414.4 Da

Molecular weight: 3416.9 Da

Number of bridges: 7

allorf_093163_093369 - Class II

Cleavage pHMM score: -1.40

RODEO score: 0

Monoisotopic mass: 6014.4 Da

Molecular weight: 6018.1 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 6036.1 Da N = 1; 6054.1 Da N = 2; 6072.1 Da N = 3; 6090.1 Da N = 4; 6108.2 Da N = 5; 6126.2 Da N = 6; 6144.2 Da N = 7; 6162.2 Da N = 8

allorf_072089_072178 - Class II

Cleavage pHMM score: -5.20

RODEO score: 0

Monoisotopic mass: 1380.6 Da

Molecular weight: 1381.6 Da

Number of bridges: 2

allorf_076310_076468 - Class II

Cleavage pHMM score: -7.30

RODEO score: 0

Monoisotopic mass: 337.1 Da

Molecular weight: 337.4 Da

Number of bridges: 1

allorf_093304_093480 - Class II

Cleavage pHMM score: -6.40

RODEO score: 0

Monoisotopic mass: 5009.6 Da

Molecular weight: 5012.7 Da

Number of bridges: 1

Alternative weights: (assuming N unmodified Ser/Thr residues); 5030.7 Da N = 1; 5048.7 Da N = 2; 5066.7 Da N = 3; 5084.7 Da N = 4; 5102.8 Da N = 5; 5120.8 Da N = 6

allorf_093330_093434 - Class II

Cleavage pHMM score: -7.00

RODEO score: 0

Monoisotopic mass: 2452.2 Da

Molecular weight: 2453.9 Da

Number of bridges: 1

c00005_NZ_JAAX.. - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 24,143 - 45,828 nt. (total: 21,686 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001514.1	0.18	Other	aristeromycin	Streptomyces citricolor
BGC0001387.1	0.16	Other	nucleocidin	Streptomyces calvus
BGC0001120.1	0.13	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000695.1	0.10	Saccharide	fortimicin	Micromonospora olivasterospora
BGC0001591.1	0.09	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.09	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001302.1	0.07	Other	lomofungin	Streptomyces lomondensis
BGC0000935.1	0.06	Other (Aminocoumarin), Polyketide	esmeraldin	Streptomyces antibioticus
BGC0000689.1	0.06	Saccharide	2-deoxystreptamine	Micromonospora echinospora
BGC0000806.1	0.05	Saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001514.1	0.50	Other	aristeromycin	Streptomyces citricolor
BGC0001387.1	0.47	Other	nucleocidin	Streptomyces calvus
BGC0001120.1	0.42	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000695.1	0.35	Saccharide	fortimicin	Micromonospora olivasterospora
BGC0001591.1	0.32	Other	fatty acid enol ester	uncultured bacterium CSLC2
BGC0001688.1	0.32	Other	N-tetradecanoyl tyrosine	uncultured bacterium CSLC2
BGC0001302.1	0.27	Other	lomofungin	Streptomyces lomondensis
BGC0000935.1	0.26	Other (Aminocoumarin), Polyketide	esmeraldin	Streptomyces antibioticus
BGC0000689.1	0.24	Saccharide	2-deoxystreptamine	Micromonospora echinospora
BGC0000806.1	0.23	Saccharide	phosphonoglycans	Glycomyces sp. NRRL B-16210

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00011_NZ_JAAX.. - Region 1 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 192 - 10,752 nt. (total: 10,561 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.1	0.17	RiPP	circularin A	Clostridium beijerinckii
BGC0000616.1	0.17	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000486.1	0.16	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000494.1	0.16	RiPP	uberolysin	Streptococcus uberis
BGC0001639.1	0.15	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000572.1	0.15	RiPP	capistruin	Burkholderia thailandensis E444
BGC0001887.1	0.15	RiPP	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000792.1	0.14	Saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000802.1	0.14	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000019.1	0.13	Polyketide	angolamycin	Streptomyces eurythermus

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000488.1	0.48	RiPP	circularin A	Clostridium beijerinckii
BGC0000616.1	0.48	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0000486.1	0.47	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0000494.1	0.46	RiPP	uberolysin	Streptococcus uberis
BGC0001639.1	0.45	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000572.1	0.45	RiPP	capistruin	Burkholderia thailandensis E444
BGC0001887.1	0.45	RiPP	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0000792.1	0.44	Saccharide	polysaccharide	Enterococcus faecalis OG1RF
BGC0000802.1	0.43	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000019.1	0.42	Polyketide	angolamycin	Streptomyces eurythermus

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00011_NZ_JAAX.. - Region 2 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 305,038 - 325,586 nt. (total: 20,549 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001291.1	0.19	RiPP	enterocin NKR-5-3B	Enterococcus faecium
BGC0000616.1	0.16	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0001887.1	0.14	RiPP	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0001973.1	0.14	Other	fervenulin	Streptomyces hiroshimensis
BGC0001972.1	0.14	Other	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001928.1	0.13	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001210.1	0.13	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001607.1	0.13	Other	gilvusmycin	Streptomyces sp. NRRL B-1347
BGC0001684.1	0.13	Other	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000521.1	0.13	RiPP	lacticin 481	Lactococcus lactis subsp. lactis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001291.1	0.50	RiPP	enterocin NKR-5-3B	Enterococcus faecium
BGC0000616.1	0.46	RiPP	amylocyclicin	Bacillus velezensis FZB42
BGC0001887.1	0.44	RiPP	huazacin	Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
BGC0001973.1	0.43	Other	fervenulin	Streptomyces hiroshimensis
BGC0001972.1	0.43	Other	toxoflavin, fervenulin	Streptomyces hiroshimensis
BGC0001928.1	0.42	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001210.1	0.42	RiPP	pseudomycoicidin	Bacillus pseudomycoides DSM 12442
BGC0001607.1	0.42	Other	gilvusmycin	Streptomyces sp. NRRL B-1347
BGC0001684.1	0.42	Other	N-acyloxyacyl glutamine	Klebsiella variicola
BGC0000521.1	0.42	RiPP	lacticin 481	Lactococcus lactis subsp. lactis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00017_NZ_JAAX.. - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 18,646 - 38,939 nt. (total: 20,294 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002031.1	0.17	Alkaloid	kitasetaline	Kitasatospora setae KM-6054
BGC0001526.1	0.17	Other	bartolosides E, bartolosides F, bartolosides G, bartolosides H, bartolosides I, bartolosides J, bartolosides K	Synechocystis salina LEGE 06099
BGC0000554.1	0.17	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001496.1	0.16	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000548.1	0.16	RiPP	salivaricin A	Streptococcus salivarius
BGC0001914.1	0.16	Other	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001529.1	0.16	Alkaloid	bezastatin derivates	Streptomyces sp. RI18
BGC0000810.1	0.16	Alkaloid	benzoxazinone DIMBOA	Zea mays
BGC0001634.1	0.16	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001521.1	0.16	NRP	auriculamide	Herpetosiphon aurantiacus DSM 785

Reference	Similarity score	Type	Compound(s)	Organism
BGC0002031.1	0.49	Alkaloid	kitasetaline	Kitasatospora setae KM-6054
BGC0001526.1	0.48	Other	bartolosides E, bartolosides F, bartolosides G, bartolosides H, bartolosides I, bartolosides J, bartolosides K	Synechocystis salina LEGE 06099
BGC0000554.1	0.48	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001496.1	0.47	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000548.1	0.47	RiPP	salivaricin A	Streptococcus salivarius
BGC0001914.1	0.47	Other	benzastatin J, 7-hydroxyl benzastatin B, 7-hydroxyl O-demethylbenzastatin A, JBIR-67, 7-hydroxyl benzastatin F, 7-hydroxyl O-demethylbenzastatin D, O-demethylvirantmycin, 7-hydroxyl benzastatin D, virantmycin, benzastatin K, methylbenzastatin K	Streptomyces sp. RI18
BGC0001529.1	0.47	Alkaloid	bezastatin derivates	Streptomyces sp. RI18
BGC0000810.1	0.47	Alkaloid	benzoxazinone DIMBOA	Zea mays
BGC0001634.1	0.47	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001521.1	0.47	NRP	auriculamide	Herpetosiphon aurantiacus DSM 785

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00033_NZ_JAAX.. - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 1 - 11,874 nt. (total: 11,874 nt) Show pHMM detection rules used

Region on contig edge.

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000294.1	0.15	NRP	acinetobactin	Acinetobacter baumannii
BGC0001496.1	0.15	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000554.1	0.15	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001120.1	0.13	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000802.1	0.13	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000496.1	0.12	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.11	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.1	0.11	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.1	0.11	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000592.1	0.11	RiPP	microviridin B	Microcystis aeruginosa NIES-298

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000294.1	0.46	NRP	acinetobactin	Acinetobacter baumannii
BGC0001496.1	0.45	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0000554.1	0.45	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0001120.1	0.42	NRP, Polyketide	burkholderic acid	Burkholderia thailandensis E264
BGC0000802.1	0.42	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000496.1	0.40	RiPP	AmfS	Streptomyces griseus subsp. griseus NBRC 13350
BGC0000518.1	0.38	RiPP	informatipeptin	Streptomyces viridochromogenes DSM 40736
BGC0000519.1	0.38	RiPP	labyrinthopeptin A2, labyrinthopeptin A1, labyrinthopeptin A3	Actinomadura namibiensis
BGC0000501.1	0.38	RiPP	catenulipeptin	Catenulispora acidiphila DSM 44928
BGC0000592.1	0.38	RiPP	microviridin B	Microcystis aeruginosa NIES-298

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00033_NZ_JAAX.. - Region 2 - RRE-containing

Download region GenBank file

Download region SVG

Location: 118,203 - 139,174 nt. (total: 20,972 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000486.1	0.16	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001928.1	0.16	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001551.1	0.16	RiPP	citrulassin E	Streptomyces glaucescens
BGC0000802.1	0.16	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000554.1	0.16	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000516.1	0.16	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000928.1	0.15	Other	T3 toxin	Cylindrospermopsis raciborskii T3
BGC0000188.1	0.15	Alkaloid	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000504.1	0.15	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001484.1	0.15	Other	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000486.1	0.47	RiPP	butyrivibriocin AR10	Butyrivibrio fibrisolvens
BGC0001928.1	0.47	Other	(2R,3S,4S)-5-fluoro-2,3,4-trihydroxypentanoic acid	Streptomyces sp. MA37
BGC0001551.1	0.46	RiPP	citrulassin E	Streptomyces glaucescens
BGC0000802.1	0.46	Saccharide	succinoglycan	Sinorhizobium meliloti
BGC0000554.1	0.46	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998
BGC0000516.1	0.46	RiPP	geobacillin II	Geobacillus thermodenitrificans
BGC0000928.1	0.45	Other	T3 toxin	Cylindrospermopsis raciborskii T3
BGC0000188.1	0.45	Alkaloid	saxitoxin, neosaxitoxin, decarbamoylsaxitoxin, gonyautoxin 3, gonyautoxin 2	Cylindrospermopsis raciborskii T3
BGC0000504.1	0.45	RiPP	cytolysin ClyLl, cytolysin ClyLs	Plasmid pAD1
BGC0001484.1	0.45	Other	2'-chloropentostatin, 2'-amino-2'-deoxyadenosine	Actinomadura sp. ATCC 39365

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00033_NZ_JAAX.. - Region 3 - cyclic-lactone-autoinducer

Download region GenBank file

Download region SVG

Location: 180,483 - 201,218 nt. (total: 20,736 nt) Show pHMM detection rules used

cyclic-lactone-autoinducer: (TIGR04223 or AgrB)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001302.1	0.13	Other	lomofungin	Streptomyces lomondensis
BGC0001796.1	0.11	NRP	tauramamide	Brevibacillus laterosporus DSM 25
BGC0000452.1	0.08	NRP	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0001812.1	0.06	Polyketide	tylactone	Micromonospora chalcea subsp. izumensis
BGC0002028.1	0.05	Polyketide	frigocyclinone	Streptomyces griseus
BGC0000422.1	0.05	NRP	saframycin A, saframycin B	Streptomyces lavendulae
BGC0000203.1	0.05	Polyketide	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000269.1	0.05	Polyketide, Saccharide	SF2575	Streptomyces sp. SF2575
BGC0000279.1	0.05	Polyketide	xantholipin	Streptomyces flavogriseus
BGC0000238.1	0.05	Polyketide	lactonamycin	Streptomyces rishiriensis

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001302.1	0.41	Other	lomofungin	Streptomyces lomondensis
BGC0001796.1	0.38	NRP	tauramamide	Brevibacillus laterosporus DSM 25
BGC0000452.1	0.30	NRP	tyrocidine	Brevibacillus brevis NBRC 100599
BGC0001812.1	0.24	Polyketide	tylactone	Micromonospora chalcea subsp. izumensis
BGC0002028.1	0.24	Polyketide	frigocyclinone	Streptomyces griseus
BGC0000422.1	0.23	NRP	saframycin A, saframycin B	Streptomyces lavendulae
BGC0000203.1	0.23	Polyketide	BE-7585A	Amycolatopsis orientalis subsp. vinearia
BGC0000269.1	0.23	Polyketide, Saccharide	SF2575	Streptomyces sp. SF2575
BGC0000279.1	0.22	Polyketide	xantholipin	Streptomyces flavogriseus
BGC0000238.1	0.21	Polyketide	lactonamycin	Streptomyces rishiriensis

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00050_NZ_JAAX.. - Region 1 - ranthipeptide

Download region GenBank file

Download region SVG

Location: 103,431 - 132,066 nt. (total: 28,636 nt) Show pHMM detection rules used

ranthipeptide: (TIGR03973 or SCIFF or (cds(PF04055 and (TIGR04085 or SPASM)) and minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE]) and not (TIGR01716 or subtilosin or TIGR02111 or TIGR03966 or TIGR04103 or YcaO or TIGR03882)))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.1	0.20	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001550.1	0.19	RiPP	citrulassin D	Streptomyces katrae
BGC0001552.1	0.19	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.1	0.19	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.1	0.19	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001889.1	0.18	RiPP	fusilassin	Thermobifida fusca YX
BGC0001496.1	0.16	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0001639.1	0.16	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000571.1	0.16	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000554.1	0.16	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Reference	Similarity score	Type	Compound(s)	Organism
BGC0001645.1	0.53	RiPP	lagmysin	Streptomyces sp. NRRL S-118
BGC0001550.1	0.51	RiPP	citrulassin D	Streptomyces katrae
BGC0001552.1	0.51	RiPP	citrulassin F	Streptomyces avermitilis MA-4680 = NBRC 14893
BGC0001634.1	0.51	RiPP	keywimysin	Streptomyces sp. NRRL F-5702
BGC0001549.1	0.51	RiPP	citrulassin B	Streptomyces aurantiacus JA 4570
BGC0001889.1	0.49	RiPP	fusilassin	Thermobifida fusca YX
BGC0001496.1	0.46	RiPP	actinokineosin	Actinokineospora spheciospongiae
BGC0001639.1	0.46	RiPP	klebsidin	Klebsiella pneumoniae
BGC0000571.1	0.46	RiPP	burhizin	Paraburkholderia rhizoxinica HKI 454
BGC0000554.1	0.46	RiPP	SRO15-3108	Streptomyces filamentosus NRRL 15998

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names

c00053_NZ_JAAX.. - Region 1 - RRE-containing

Download region GenBank file

Download region SVG

Location: 5,875 - 26,132 nt. (total: 20,258 nt) Show pHMM detection rules used

RRE-containing: minimum(1, [Bottromycin_Methyltransferase_RRE, Cyanobactin_D_RRE, Cytolysin_C_RRE, Goadsporin_CD_RRE, Heterocycloanthracin_C_RRE, Lanthipeptide_LanB_RRE, Lasso_Fused_RRE, Mycofactocin_RRE, NHLP_CD_RRE, Other_Sactipeptide_rSAM_RRE, Pantocin_Microcin_RRE, Plantazolicin_C_RRE, PlpY_RRE, PqqD_RRE, Proteusin_Epimerase_RRE, Proteusin_Methyltransferase_RRE, Quinohemoprotein_rSAM_RRE, Ranthipeptide_rSAM_RRE, Stand_Alone_Lasso_RRE, Streptide_RRE, Subtilosin_rSAM_RRE, Thiaglutamate_B_RRE, Thiaglutamate_G_RRE, Thiaglutamate_I_RRE, Thiopeptide_F_RRE, Thuricin_rSAM_RRE, Thurincin_rSAM_RRE, Trifolitoxin_RRE])

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

MIBiG comparison

KnownClusterBlast

Pfam domains

TIGRFAM domains

Similar gene clusters

Analysis type:

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000760.1	0.29	Saccharide	emulsan	Acinetobacter venetianus RAG-1 = CIP 110063
BGC0000786.1	0.28	Saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000763.1	0.27	Saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0000782.1	0.27	Saccharide	O-antigen	Burkholderia pseudomallei 1026b
BGC0000787.1	0.26	Saccharide	O-antigen	Escherichia coli
BGC0000777.1	0.25	Saccharide	lipopolysaccharide	Escherichia coli
BGC0000790.1	0.20	Saccharide	O-antigen	Escherichia coli
BGC0000887.1	0.16	Alkaloid	saxitoxin, gonyautoxin 2, gonyautoxin 3, toxin C2, toxin C3, gonyautoxin 5, decarbamoylsaxitoxin, decarbamoylgonyautoxin 2, decarbamoylgonyautoxin 3	Dolichospermum circinale AWQC131C
BGC0001987.1	0.15	Polyketide	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000928.1	0.15	Other	T3 toxin	Cylindrospermopsis raciborskii T3

Reference	Similarity score	Type	Compound(s)	Organism
BGC0000760.1	0.62	Saccharide	emulsan	Acinetobacter venetianus RAG-1 = CIP 110063
BGC0000786.1	0.61	Saccharide	O-antigen	Edwardsiella ictaluri 93-146
BGC0000763.1	0.61	Saccharide	stewartan	Pantoea stewartii subsp. stewartii DC283
BGC0000782.1	0.60	Saccharide	O-antigen	Burkholderia pseudomallei 1026b
BGC0000787.1	0.59	Saccharide	O-antigen	Escherichia coli
BGC0000777.1	0.58	Saccharide	lipopolysaccharide	Escherichia coli
BGC0000790.1	0.52	Saccharide	O-antigen	Escherichia coli
BGC0000887.1	0.46	Alkaloid	saxitoxin, gonyautoxin 2, gonyautoxin 3, toxin C2, toxin C3, gonyautoxin 5, decarbamoylsaxitoxin, decarbamoylgonyautoxin 2, decarbamoylgonyautoxin 3	Dolichospermum circinale AWQC131C
BGC0001987.1	0.45	Polyketide	koreenceine A, koreenceine B, koreenceine C, koreenceine D	Pseudomonas koreensis
BGC0000928.1	0.45	Other	T3 toxin	Cylindrospermopsis raciborskii T3

Similar known gene clusters

No matches found.

Detailed Pfam domain annotation

Selected features only

Expand to show all names

Detailed TIGRFAM domain annotation

Selected features only

Expand to show all names